FISNA - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FISNA - Fish-specific NACHT associated domain

PFAM:	PF14484	Sequences: LKSSLKKKFQCVFEGIAKAGNPTLLNQIYTELYITEGGSGEVNNEHEVRQIETASRKPDRQETPIKCEDIFK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	72 (72)
Sequences:	1016 (553)
Seq/√Len:	65.2
META:	0.079

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
37_G	42_V	3.097	1.00
6_K	37_G	2.942	1.00
13_F	17_A	2.653	1.00
69_D	72_K	2.530	1.00
58_P	61_Q	2.142	1.00
59_D	63_T	2.045	1.00
3_S	7_K	1.873	1.00
25_L	29_Y	1.786	1.00
13_F	21_N	1.755	1.00
9_F	68_E	1.637	0.99
52_E	55_S	1.633	0.99
23_T	26_N	1.590	0.99
7_K	10_Q	1.550	0.99
57_K	64_P	1.512	0.99
64_P	68_E	1.467	0.98
10_Q	27_Q	1.459	0.98
18_K	22_P	1.452	0.98
15_G	28_I	1.435	0.98
63_T	70_I	1.410	0.98
8_K	43_N	1.408	0.98
60_R	68_E	1.403	0.98
21_N	38_G	1.348	0.97
61_Q	64_P	1.336	0.97
12_V	49_R	1.318	0.97
19_A	66_K	1.301	0.96
13_F	16_I	1.301	0.96
30_T	37_G	1.293	0.96
13_F	22_P	1.283	0.96
59_D	62_E	1.272	0.96
4_S	70_I	1.152	0.93
31_E	49_R	1.141	0.93
28_I	40_G	1.137	0.93
27_Q	40_G	1.101	0.91
18_K	38_G	1.097	0.91
60_R	67_C	1.096	0.91
2_K	6_K	1.092	0.91
54_A	58_P	1.077	0.90
39_S	47_E	1.061	0.90
10_Q	24_L	1.053	0.89
11_C	22_P	1.044	0.89
21_N	36_E	1.005	0.87
19_A	37_G	0.967	0.85
15_G	46_H	0.957	0.84
65_I	69_D	0.952	0.84
57_K	60_R	0.945	0.84
21_N	65_I	0.938	0.83
1_L	53_T	0.936	0.83
16_I	29_Y	0.899	0.80
16_I	20_G	0.878	0.79
67_C	70_I	0.877	0.79
15_G	25_L	0.871	0.78
34_I	41_E	0.864	0.78
38_G	70_I	0.863	0.78
15_G	20_G	0.835	0.75
31_E	53_T	0.816	0.74
55_S	63_T	0.816	0.74
1_L	62_E	0.815	0.74
53_T	56_R	0.799	0.72
3_S	24_L	0.792	0.71
5_L	38_G	0.789	0.71
2_K	67_C	0.774	0.70
8_K	35_T	0.769	0.69
16_I	61_Q	0.758	0.68
25_L	30_T	0.733	0.65
8_K	21_N	0.722	0.64
66_K	69_D	0.708	0.63
1_L	15_G	0.707	0.63
39_S	44_N	0.703	0.62
54_A	57_K	0.694	0.61
57_K	62_E	0.680	0.60
10_Q	67_C	0.680	0.60
22_P	47_E	0.677	0.59
15_G	30_T	0.676	0.59
5_L	31_E	0.676	0.59
29_Y	58_P	0.664	0.58
39_S	67_C	0.652	0.56
12_V	59_D	0.644	0.56
2_K	58_P	0.631	0.54
46_H	69_D	0.626	0.53
40_G	71_F	0.621	0.53
39_S	63_T	0.616	0.52
3_S	17_A	0.606	0.51
39_S	43_N	0.595	0.50
33_Y	38_G	0.593	0.50
6_K	45_E	0.593	0.50
28_I	38_G	0.592	0.49
31_E	66_K	0.592	0.49
37_G	43_N	0.573	0.47
53_T	60_R	0.566	0.46
44_N	53_T	0.563	0.46
12_V	44_N	0.551	0.45
15_G	37_G	0.543	0.44
45_E	49_R	0.541	0.44
47_E	52_E	0.538	0.43
13_F	20_G	0.538	0.43
15_G	50_Q	0.535	0.43
24_L	33_Y	0.534	0.43
61_Q	67_C	0.529	0.42
33_Y	72_K	0.523	0.41
19_A	22_P	0.523	0.41
16_I	19_A	0.522	0.41
19_A	68_E	0.513	0.40
56_R	66_K	0.511	0.40
36_E	48_V	0.510	0.40
23_T	32_L	0.506	0.40
18_K	45_E	0.505	0.39
7_K	27_Q	0.503	0.39
50_Q	70_I	0.500	0.39

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4kxfK	4	0.75	45.7	0.84	Contact Map
3nuhB	1	0.5833	7.2	0.891	Contact Map
2xcsB	2	0.7083	4.6	0.901	Contact Map
3k9fC	1	0.6806	3.6	0.905	Contact Map
1fioA	1	0.7917	3.5	0.906	Contact Map
3c65A	1	0.75	3	0.909	Contact Map
2xkjE	2	0.8611	3	0.909	Contact Map
4gfhA	2	0.8472	2.8	0.911	Contact Map
2nrrA	1	0.6944	2.6	0.912	Contact Map
3l4jA	1	0.8889	2.5	0.913	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0046 seconds.