PT-TG - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PT-TG - Pre-toxin TG

PFAM:	PF14449	Sequences: QKELLSLALDFIPEVGGVKDAYEAITGKDPITGEKLSTWDRALAGVGALAGLIPVGKAGKAGKKGKKGAKAAKAAKKAT	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	79 (72)
Sequences:	740 (592)
Seq/√Len:	69.7
META:	0.63

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
6_S	29_D	3.616	1.00
10_D	19_K	3.432	1.00
37_S	40_D	2.648	1.00
10_D	20_D	2.319	1.00
36_L	40_D	2.312	1.00
19_K	23_E	2.273	1.00
13_P	16_G	1.988	1.00
6_S	19_K	1.870	1.00
24_A	41_R	1.844	1.00
36_L	41_R	1.693	1.00
20_D	23_E	1.673	1.00
29_D	32_T	1.605	0.99
38_T	42_A	1.603	0.99
59_G	63_K	1.544	0.99
23_E	30_P	1.539	0.99
38_T	41_R	1.532	0.99
12_I	15_V	1.401	0.98
47_G	50_A	1.292	0.97
34_E	40_D	1.276	0.97
24_A	48_A	1.216	0.96
71_A	75_A	1.162	0.94
9_L	19_K	1.156	0.94
68_G	72_A	1.150	0.94
15_V	35_K	1.141	0.94
24_A	36_L	1.131	0.94
70_K	73_K	1.092	0.92
19_K	29_D	1.091	0.92
23_E	44_A	1.077	0.92
9_L	12_I	1.048	0.91
49_L	53_I	1.037	0.90
71_A	74_A	1.036	0.90
14_E	23_E	1.012	0.89
17_G	20_D	1.007	0.89
44_A	47_G	1.003	0.89
65_G	69_A	0.999	0.89
50_A	53_I	0.998	0.89
47_G	54_P	0.992	0.88
20_D	41_R	0.979	0.88
23_E	36_L	0.976	0.87
41_R	45_G	0.975	0.87
14_E	18_V	0.958	0.86
39_W	42_A	0.948	0.86
62_G	65_G	0.946	0.86
50_A	54_P	0.924	0.84
24_A	27_G	0.918	0.84
72_A	75_A	0.903	0.83
28_K	32_T	0.879	0.81
69_A	74_A	0.867	0.80
28_K	35_K	0.856	0.80
47_G	52_L	0.856	0.80
45_G	64_K	0.853	0.79
59_G	62_G	0.836	0.78
17_G	51_G	0.834	0.78
41_R	44_A	0.828	0.77
11_F	70_K	0.820	0.77
15_V	19_K	0.820	0.77
68_G	73_K	0.818	0.76
6_S	10_D	0.805	0.75
55_V	61_A	0.793	0.74
62_G	66_K	0.787	0.74
13_P	19_K	0.786	0.73
55_V	59_G	0.785	0.73
42_A	45_G	0.778	0.73
42_A	46_V	0.771	0.72
34_E	46_V	0.770	0.72
22_Y	26_T	0.767	0.72
20_D	44_A	0.763	0.71
65_G	68_G	0.763	0.71
10_D	13_P	0.762	0.71
16_G	19_K	0.732	0.68
31_I	69_A	0.720	0.67
4_L	62_G	0.718	0.67
18_V	22_Y	0.708	0.66
13_P	23_E	0.705	0.65
59_G	65_G	0.704	0.65
61_A	73_K	0.704	0.65
20_D	24_A	0.698	0.64
5_L	12_I	0.692	0.64
56_G	60_K	0.660	0.60
4_L	8_A	0.658	0.60
9_L	23_E	0.657	0.60
6_S	20_D	0.656	0.60
21_A	26_T	0.656	0.60
6_S	16_G	0.650	0.59
56_G	59_G	0.645	0.58
22_Y	30_P	0.641	0.58
64_K	68_G	0.641	0.58
46_V	50_A	0.638	0.57
17_G	52_L	0.632	0.57
39_W	43_L	0.629	0.56
29_D	34_E	0.619	0.55
20_D	48_A	0.601	0.53
20_D	47_G	0.590	0.52
6_S	32_T	0.588	0.51
48_A	51_G	0.574	0.50
65_G	71_A	0.572	0.50
64_K	67_K	0.567	0.49
7_L	11_F	0.560	0.48
19_K	30_P	0.552	0.47
6_S	15_V	0.549	0.47
16_G	51_G	0.543	0.46
33_G	45_G	0.534	0.45
40_D	43_L	0.522	0.44
48_A	52_L	0.521	0.43
21_A	25_I	0.517	0.43
19_K	26_T	0.509	0.42
12_I	19_K	0.508	0.42
69_A	73_K	0.500	0.41

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4g1gA	2	1	5.1	0.883	Contact Map
1g62A	1	0.557	5.1	0.883	Contact Map
2np2A	2	0.7595	4.5	0.887	Contact Map
1exeA	2	0.8354	3.9	0.89	Contact Map
2mluA	1	0.3418	3.7	0.891	Contact Map
1g61A	1	0.5443	3.6	0.891	Contact Map
4n1vA	2	0.7089	3.5	0.893	Contact Map
4pt4A	2	0.8354	3.2	0.894	Contact Map
1p71A	2	0.7722	3	0.896	Contact Map
1owfA	1	0.7848	2.7	0.899	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0048 seconds.