OTT_1508_deam - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

OTT_1508_deam - OTT_1508-like deaminase

PFAM:	PF14441	Sequences: HAEIQLLLHLEKNPRPLKFLPRYIGVSKLCCYLCHLFIRALHGKGYEIKVRGSHGKLYPNWRLPD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	65 (64)
Sequences:	1149 (1013)
Seq/√Len:	126.7
META:	0.561

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
23_Y	51_R	3.514	1.00
33_L	57_L	3.044	1.00
7_L	38_I	2.983	1.00
29_L	52_G	2.789	1.00
4_I	37_F	2.402	1.00
30_C	52_G	2.351	1.00
35_H	53_S	2.341	1.00
25_G	51_R	2.172	1.00
9_H	13_N	2.084	1.00
26_V	30_C	1.929	1.00
30_C	50_V	1.819	1.00
35_H	39_R	1.628	1.00
61_W	64_P	1.524	1.00
54_H	58_Y	1.478	1.00
38_I	50_V	1.458	1.00
59_P	62_R	1.439	1.00
28_K	54_H	1.414	1.00
36_L	53_S	1.401	1.00
15_R	18_K	1.389	1.00
32_Y	57_L	1.380	1.00
8_L	12_K	1.340	1.00
32_Y	36_L	1.321	1.00
2_A	54_H	1.302	1.00
23_Y	29_L	1.187	0.99
42_H	45_G	1.136	0.99
33_L	58_Y	1.063	0.99
13_N	17_L	1.055	0.98
40_A	46_Y	1.039	0.98
16_P	19_F	0.982	0.98
40_A	48_I	0.980	0.97
40_A	43_G	0.973	0.97
4_I	38_I	0.927	0.96
17_L	20_L	0.924	0.96
25_G	35_H	0.922	0.96
4_I	8_L	0.904	0.96
33_L	61_W	0.880	0.95
33_L	37_F	0.875	0.95
41_L	44_K	0.866	0.95
46_Y	49_K	0.855	0.94
42_H	46_Y	0.842	0.94
10_L	14_P	0.797	0.92
32_Y	37_F	0.795	0.92
23_Y	26_V	0.768	0.91
23_Y	52_G	0.766	0.91
31_C	34_C	0.764	0.90
26_V	50_V	0.763	0.90
2_A	51_R	0.758	0.90
13_N	44_K	0.746	0.89
57_L	62_R	0.741	0.89
12_K	55_G	0.729	0.88
37_F	48_I	0.727	0.88
13_N	18_K	0.718	0.88
37_F	56_K	0.712	0.87
13_N	16_P	0.709	0.87
17_L	21_P	0.701	0.86
42_H	47_E	0.684	0.85
12_K	47_E	0.682	0.85
8_L	11_E	0.679	0.84
18_K	21_P	0.669	0.84
7_L	25_G	0.659	0.83
9_H	27_S	0.659	0.83
4_I	61_W	0.648	0.82
9_H	20_L	0.643	0.81
5_Q	8_L	0.635	0.80
24_I	50_V	0.626	0.79
6_L	33_L	0.621	0.79
26_V	52_G	0.618	0.79
43_G	47_E	0.616	0.78
50_V	60_N	0.614	0.78
40_A	44_K	0.608	0.77
41_L	46_Y	0.607	0.77
26_V	38_I	0.602	0.77
2_A	58_Y	0.601	0.77
53_S	56_K	0.600	0.76
44_K	48_I	0.600	0.76
30_C	53_S	0.593	0.76
36_L	39_R	0.582	0.74
25_G	63_L	0.581	0.74
8_L	63_L	0.566	0.72
43_G	46_Y	0.557	0.71
9_H	15_R	0.552	0.70
8_L	29_L	0.550	0.70
13_N	21_P	0.545	0.69
11_E	59_P	0.536	0.68
5_Q	11_E	0.530	0.67
24_I	37_F	0.529	0.67
7_L	37_F	0.520	0.66
29_L	50_V	0.519	0.66
27_S	38_I	0.518	0.66
27_S	56_K	0.515	0.65
52_G	60_N	0.514	0.65
42_H	49_K	0.504	0.63
52_G	55_G	0.503	0.63
30_C	33_L	0.503	0.63
35_H	55_G	0.502	0.63
29_L	35_H	0.500	0.63

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2mzzA	1	0.9846	88.2	0.738	Contact Map
4j4jA	1	0.9846	87.9	0.74	Contact Map
3v4kA	3	0.9692	87	0.743	Contact Map
3vowA	1	0.9846	87	0.743	Contact Map
4xxoA	2	0.9692	80.1	0.764	Contact Map
2nytA	3	0.9692	77.5	0.77	Contact Map
4p9cA	5	0.8	61.9	0.794	Contact Map
1vq2A	3	0.9385	57.1	0.8	Contact Map
1wwrA	3	1	57.1	0.8	Contact Map
4eg2A	4	0.9538	55.6	0.802	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0049 seconds.