Clr5 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Clr5 - Clr5 domain

PFAM:	PF14420	Sequences: EEDWEAHKPIITRLYIDENKTLKEVMEIMEEEHGFKASERQYKRRLKKWGFRK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	53 (52)
Sequences:	1178 (1012)
Seq/√Len:	140.3
META:	0.281

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
13_R	18_E	2.711	1.00
12_T	51_F	2.609	1.00
39_E	43_K	2.356	1.00
11_I	46_L	2.216	1.00
45_R	48_K	2.082	1.00
7_H	11_I	1.868	1.00
30_E	36_K	1.858	1.00
27_E	31_E	1.781	1.00
28_I	32_E	1.720	1.00
20_K	24_E	1.705	1.00
14_L	25_V	1.675	1.00
8_K	12_T	1.607	1.00
13_R	17_D	1.573	1.00
29_M	42_Y	1.505	1.00
12_T	16_I	1.365	1.00
40_R	44_R	1.344	1.00
7_H	10_I	1.343	1.00
37_A	42_Y	1.289	1.00
10_I	32_E	1.265	1.00
26_M	39_E	1.265	1.00
20_K	28_I	1.225	1.00
46_L	51_F	1.164	0.99
3_D	6_A	1.121	0.99
29_M	46_L	1.066	0.99
14_L	28_I	1.045	0.99
46_L	52_R	1.028	0.99
5_E	8_K	1.022	0.99
26_M	30_E	1.013	0.99
41_Q	45_R	1.006	0.98
10_I	33_H	0.993	0.98
8_K	51_F	0.987	0.98
10_I	13_R	0.929	0.97
29_M	37_A	0.895	0.97
22_L	42_Y	0.889	0.97
16_I	51_F	0.882	0.97
12_T	17_D	0.871	0.96
23_K	39_E	0.870	0.96
21_T	24_E	0.858	0.96
2_E	41_Q	0.852	0.96
4_W	37_A	0.840	0.95
24_E	27_E	0.814	0.95
20_K	25_V	0.757	0.92
41_Q	44_R	0.754	0.92
15_Y	53_K	0.753	0.92
10_I	14_L	0.737	0.91
26_M	29_M	0.717	0.90
9_P	12_T	0.713	0.90
40_R	43_K	0.707	0.89
7_H	29_M	0.696	0.89
21_T	47_K	0.675	0.87
19_N	48_K	0.673	0.87
21_T	25_V	0.672	0.87
42_Y	46_L	0.646	0.85
11_I	29_M	0.634	0.84
29_M	33_H	0.625	0.83
11_I	42_Y	0.617	0.82
15_Y	22_L	0.613	0.81
24_E	36_K	0.607	0.81
38_S	41_Q	0.607	0.81
44_R	47_K	0.601	0.80
22_L	25_V	0.598	0.80
6_A	36_K	0.583	0.78
15_Y	45_R	0.567	0.76
35_F	41_Q	0.565	0.76
10_I	28_I	0.557	0.75
21_T	32_E	0.556	0.75
11_I	25_V	0.554	0.75
9_P	13_R	0.539	0.73
2_E	17_D	0.534	0.72
21_T	41_Q	0.529	0.71
9_P	34_G	0.523	0.70
12_T	15_Y	0.518	0.70
27_E	48_K	0.516	0.69
25_V	42_Y	0.514	0.69
4_W	53_K	0.513	0.69
40_R	47_K	0.511	0.69
3_D	7_H	0.510	0.68
22_L	26_M	0.500	0.67

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1k78A	1	0.9245	68.8	0.749	Contact Map
2k27A	1	0.9811	51.3	0.774	Contact Map
3lapA	6	0.9057	35.4	0.796	Contact Map
1pdnC	1	0.8491	30.2	0.803	Contact Map
2ahqA	1	0.9245	29.5	0.804	Contact Map
3v4gA	5	0.9245	28.7	0.804	Contact Map
1b4aA	5	0.9057	27	0.808	Contact Map
1u78A	1	0.8679	25.3	0.81	Contact Map
4fcyA	4	0.9811	20.7	0.818	Contact Map
4trbA	2	1	15.3	0.828	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.004 seconds.