RLAN - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RLAN - RimK-like ATPgrasp N-terminal domain

PFAM:	PF14401	Sequences: ARDYLTDPEYSELRRARVINLCRSYRYQSRGYYVSLLAEARGHRVIPSVKTIQDLKSKSLYRLASEELDELIQKSLKAPIKSDEFTLSIYFGRNLAKRYDRLARQLFELFPAPLLRVTFVRRDGRWRLQSIRPISLSDLPEEHRDFFAEA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	150 (146)
Sequences:	3142 (2129)
Seq/√Len:	176.2
META:	0.867

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
104_R	108_E	4.024	1.00
3_D	7_D	3.498	1.00
117_V	128_L	3.483	1.00
106_L	117_V	3.402	1.00
13_L	16_A	3.092	1.00
88_S	116_R	2.909	1.00
88_S	143_H	2.504	1.00
89_I	103_A	2.439	1.00
86_T	116_R	2.339	1.00
97_K	100_D	2.317	1.00
120_V	129_Q	2.295	1.00
51_T	112_A	2.205	1.00
83_D	121_R	2.202	1.00
89_I	117_V	2.191	1.00
105_Q	109_L	2.157	1.00
71_L	75_S	2.129	1.00
140_P	143_H	2.089	1.00
4_Y	43_H	2.063	1.00
69_D	73_Q	1.995	1.00
86_T	118_T	1.967	1.00
93_R	100_D	1.886	1.00
139_L	143_H	1.861	1.00
55_L	133_P	1.818	1.00
46_I	111_P	1.794	1.00
139_L	147_F	1.709	1.00
144_R	148_A	1.675	1.00
88_S	94_N	1.659	1.00
69_D	125_R	1.638	1.00
7_D	10_Y	1.636	1.00
9_E	12_E	1.609	1.00
79_P	98_R	1.594	1.00
84_E	118_T	1.544	1.00
26_R	29_S	1.483	1.00
95_L	143_H	1.458	1.00
96_A	99_Y	1.451	1.00
10_Y	13_L	1.421	1.00
88_S	95_L	1.416	1.00
114_L	139_L	1.412	1.00
87_L	99_Y	1.404	1.00
112_A	133_P	1.393	1.00
82_S	96_A	1.282	1.00
60_L	110_F	1.258	1.00
9_E	13_L	1.247	1.00
94_N	103_A	1.240	1.00
116_R	134_I	1.240	1.00
39_E	50_K	1.227	1.00
6_T	10_Y	1.201	1.00
10_Y	16_A	1.169	1.00
105_Q	108_E	1.156	1.00
85_F	119_F	1.141	1.00
141_E	144_R	1.135	1.00
94_N	99_Y	1.131	1.00
72_I	75_S	1.130	1.00
53_Q	56_K	1.120	1.00
20_N	35_S	1.108	1.00
6_T	14_R	1.099	1.00
122_R	125_R	1.095	1.00
114_L	134_I	1.056	1.00
50_K	54_D	1.053	1.00
36_L	49_V	1.021	0.99
73_Q	125_R	1.011	0.99
90_Y	140_P	1.005	0.99
64_A	110_F	1.005	0.99
61_Y	65_S	0.993	0.99
73_Q	76_L	0.988	0.99
80_I	85_F	0.985	0.99
112_A	115_L	0.981	0.99
2_R	30_R	0.978	0.99
27_Y	32_Y	0.977	0.99
21_L	114_L	0.972	0.99
24_S	56_K	0.957	0.99
8_P	12_E	0.949	0.99
3_D	9_E	0.943	0.99
87_L	102_L	0.941	0.99
75_S	99_Y	0.938	0.99
85_F	126_W	0.938	0.99
119_F	126_W	0.937	0.99
31_G	38_A	0.934	0.99
80_I	84_E	0.924	0.99
5_L	30_R	0.924	0.99
37_L	41_R	0.918	0.99
80_I	99_Y	0.917	0.99
136_L	144_R	0.913	0.99
85_F	88_S	0.908	0.99
31_G	35_S	0.904	0.99
38_A	41_R	0.903	0.99
52_I	56_K	0.902	0.99
94_N	100_D	0.884	0.98
12_E	15_R	0.882	0.98
21_L	24_S	0.875	0.98
134_I	138_D	0.868	0.98
25_Y	29_S	0.866	0.98
89_I	115_L	0.861	0.98
51_T	133_P	0.857	0.98
82_S	85_F	0.852	0.98
114_L	147_F	0.851	0.98
121_R	126_W	0.849	0.98
55_L	115_L	0.846	0.98
7_D	11_S	0.843	0.98
53_Q	110_F	0.842	0.98
95_L	146_F	0.842	0.98
141_E	145_D	0.841	0.98
34_V	126_W	0.839	0.98
65_S	128_L	0.836	0.98
101_R	104_R	0.835	0.98
35_S	52_I	0.831	0.98
34_V	43_H	0.831	0.98
3_D	70_E	0.806	0.97
48_S	111_P	0.806	0.97
17_R	44_R	0.797	0.97
22_C	34_V	0.793	0.97
3_D	10_Y	0.792	0.97
55_L	61_Y	0.786	0.97
71_L	74_K	0.782	0.96
121_R	124_G	0.778	0.96
144_R	147_F	0.773	0.96
66_E	70_E	0.766	0.96
36_L	41_R	0.762	0.96
37_L	40_A	0.758	0.96
20_N	31_G	0.755	0.96
44_R	51_T	0.753	0.96
75_S	103_A	0.750	0.96
117_V	131_I	0.749	0.95
49_V	53_Q	0.748	0.95
2_R	10_Y	0.745	0.95
81_K	88_S	0.743	0.95
22_C	40_A	0.732	0.95
145_D	148_A	0.732	0.95
53_Q	111_P	0.730	0.95
28_Q	54_D	0.725	0.95
39_E	61_Y	0.723	0.95
110_F	131_I	0.717	0.94
80_I	83_D	0.715	0.94
55_L	112_A	0.715	0.94
94_N	143_H	0.715	0.94
11_S	16_A	0.705	0.94
57_S	64_A	0.699	0.94
70_E	74_K	0.697	0.93
19_I	91_F	0.694	0.93
79_P	142_E	0.692	0.93
56_K	61_Y	0.690	0.93
46_I	107_F	0.687	0.93
139_L	144_R	0.681	0.93
31_G	52_I	0.680	0.93
30_R	50_K	0.678	0.92
118_T	124_G	0.677	0.92
24_S	29_S	0.674	0.92
45_V	146_F	0.666	0.92
105_Q	111_P	0.659	0.91
22_C	126_W	0.656	0.91
62_R	65_S	0.651	0.91
59_S	128_L	0.646	0.91
6_T	11_S	0.644	0.90
120_V	127_R	0.640	0.90
38_A	43_H	0.636	0.90
44_R	108_E	0.633	0.90
76_L	85_F	0.632	0.90
78_A	129_Q	0.627	0.89
88_S	114_L	0.618	0.89
64_A	109_L	0.618	0.89
74_K	85_F	0.610	0.88
59_S	62_R	0.608	0.88
90_Y	146_F	0.606	0.88
8_P	23_R	0.605	0.87
100_D	103_A	0.605	0.87
88_S	134_I	0.603	0.87
76_L	119_F	0.603	0.87
49_V	107_F	0.600	0.87
76_L	80_I	0.593	0.86
131_I	136_L	0.591	0.86
36_L	40_A	0.587	0.86
134_I	140_P	0.584	0.86
95_L	147_F	0.579	0.85
87_L	119_F	0.578	0.85
56_K	60_L	0.572	0.84
12_E	39_E	0.561	0.83
128_L	147_F	0.561	0.83
74_K	101_R	0.558	0.83
58_K	61_Y	0.558	0.83
96_A	143_H	0.557	0.83
37_L	43_H	0.553	0.82
106_L	137_S	0.552	0.82
118_T	132_R	0.552	0.82
57_S	60_L	0.549	0.82
48_S	110_F	0.548	0.82
68_L	102_L	0.543	0.81
25_Y	135_S	0.543	0.81
5_L	17_R	0.539	0.81
71_L	105_Q	0.539	0.81
24_S	51_T	0.539	0.81
85_F	96_A	0.539	0.81
95_L	142_E	0.538	0.81
45_V	93_R	0.535	0.80
39_E	55_L	0.534	0.80
70_E	73_Q	0.534	0.80
81_K	121_R	0.533	0.80
6_T	109_L	0.532	0.80
63_L	118_T	0.532	0.80
81_K	86_T	0.531	0.80
39_E	54_D	0.531	0.80
95_L	99_Y	0.530	0.80
28_Q	112_A	0.530	0.80
61_Y	128_L	0.529	0.80
108_E	114_L	0.526	0.79
48_S	97_K	0.525	0.79
6_T	9_E	0.523	0.79
136_L	141_E	0.523	0.79
10_Y	14_R	0.522	0.79
118_T	129_Q	0.516	0.78
7_D	16_A	0.516	0.78
23_R	39_E	0.515	0.78
3_D	13_L	0.514	0.78
7_D	12_E	0.512	0.77
49_V	131_I	0.509	0.77
93_R	104_R	0.509	0.77
87_L	117_V	0.505	0.76
3_D	6_T	0.502	0.76
48_S	61_Y	0.501	0.76
6_T	12_E	0.500	0.76

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4cs6A	1	0.56	30.8	0.93	Contact Map
3orsA	5	0.3467	19.8	0.936	Contact Map
3lp6A	5	0.3867	18.4	0.937	Contact Map
3rg8A	6	0.3533	13.5	0.941	Contact Map
3ooxA	1	0.6333	11.4	0.943	Contact Map
3on7A	4	0.56	11	0.943	Contact Map
3oowA	5	0.3467	10.8	0.944	Contact Map
3trhA	5	0.3533	10	0.944	Contact Map
4grdA	5	0.3867	9.7	0.945	Contact Map
2vk9A	1	0.7867	9.7	0.945	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.