WAK_assoc - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

WAK_assoc - Wall-associated receptor kinase C-terminal

PFAM:	PF14380	Sequences: NCSSFSTGGGSSYVFPSGDLPGSEASLNDLLGSCKEVVVVPVLGSALNTLESNLTSDGLGEALKQGFELEWNADAGDCSQCESSGGRCGYNQTSEFFVCYCSDG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	104 (96)
Sequences:	542 (446)
Seq/√Len:	45.6
META:	0.081

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
89_G	100_Y	3.716	1.00
84_S	101_C	2.445	1.00
13_Y	17_S	2.204	1.00
11_S	16_P	2.087	1.00
59_L	100_Y	2.076	1.00
38_V	97_F	1.883	0.99
15_F	18_G	1.873	0.99
62_A	67_F	1.866	0.99
39_V	91_N	1.758	0.98
33_S	98_V	1.692	0.98
63_L	70_E	1.687	0.98
48_N	52_S	1.671	0.98
81_C	88_C	1.653	0.97
25_A	28_N	1.622	0.97
62_A	66_G	1.576	0.97
86_G	99_C	1.566	0.96
34_C	78_C	1.532	0.96
34_C	81_C	1.512	0.96
44_G	62_A	1.493	0.95
9_G	16_P	1.473	0.95
75_A	97_F	1.440	0.94
101_C	104_G	1.432	0.94
34_C	88_C	1.429	0.94
71_W	90_Y	1.428	0.94
71_W	76_G	1.426	0.94
68_E	72_N	1.397	0.93
21_P	24_E	1.395	0.93
60_G	69_L	1.380	0.93
69_L	102_S	1.363	0.92
59_L	68_E	1.326	0.91
15_F	55_T	1.277	0.90
41_P	67_F	1.259	0.89
60_G	82_E	1.247	0.89
29_D	83_S	1.226	0.88
22_G	29_D	1.225	0.88
66_G	84_S	1.202	0.87
20_L	56_S	1.196	0.87
14_V	21_P	1.186	0.86
59_L	63_L	1.168	0.85
68_E	75_A	1.167	0.85
28_N	93_T	1.156	0.85
67_F	84_S	1.144	0.84
46_A	62_A	1.137	0.84
61_E	79_S	1.131	0.83
90_Y	95_E	1.127	0.83
54_L	57_D	1.125	0.83
89_G	97_F	1.114	0.82
9_G	12_S	1.111	0.82
24_E	28_N	1.110	0.82
52_S	91_N	1.110	0.82
17_S	20_L	1.108	0.82
35_K	87_R	1.095	0.81
59_L	64_K	1.082	0.80
72_N	92_Q	1.073	0.80
66_G	101_C	1.054	0.79
27_L	72_N	1.044	0.78
88_C	99_C	1.029	0.77
34_C	99_C	1.014	0.76
68_E	77_D	0.988	0.74
46_A	102_S	0.986	0.74
11_S	17_S	0.949	0.71
44_G	61_E	0.938	0.70
91_N	95_E	0.928	0.69
78_C	81_C	0.927	0.69
42_V	82_E	0.913	0.68
61_E	83_S	0.900	0.67
32_G	79_S	0.877	0.65
56_S	68_E	0.874	0.65
83_S	104_G	0.871	0.64
79_S	98_V	0.867	0.64
14_V	20_L	0.864	0.64
36_E	74_D	0.857	0.63
49_T	61_E	0.854	0.63
65_Q	75_A	0.842	0.62
46_A	104_G	0.841	0.62
78_C	88_C	0.840	0.61
39_V	68_E	0.834	0.61
45_S	50_L	0.810	0.59
44_G	47_L	0.802	0.58
42_V	54_L	0.800	0.58
33_S	37_V	0.796	0.57
46_A	75_A	0.784	0.56
20_L	93_T	0.782	0.56
77_D	98_V	0.778	0.56
16_P	94_S	0.775	0.55
81_C	99_C	0.775	0.55
19_D	24_E	0.766	0.54
73_A	77_D	0.763	0.54
65_Q	70_E	0.758	0.54
21_P	32_G	0.756	0.53
31_L	102_S	0.753	0.53
16_P	62_A	0.751	0.53
44_G	104_G	0.750	0.53
91_N	94_S	0.733	0.51
69_L	74_D	0.729	0.51
33_S	77_D	0.728	0.51
40_V	67_F	0.705	0.48
58_G	61_E	0.703	0.48
33_S	43_L	0.701	0.48
35_K	48_N	0.701	0.48
89_G	101_C	0.695	0.47
63_L	87_R	0.694	0.47
43_L	100_Y	0.686	0.47
64_K	85_G	0.682	0.46
90_Y	101_C	0.665	0.45
90_Y	100_Y	0.658	0.44
20_L	23_S	0.655	0.44
37_V	69_L	0.651	0.43
11_S	14_V	0.650	0.43
16_P	19_D	0.650	0.43
56_S	76_G	0.637	0.42
51_E	54_L	0.629	0.41
87_R	100_Y	0.626	0.41
47_L	70_E	0.625	0.41
15_F	19_D	0.622	0.40
55_T	83_S	0.621	0.40
71_W	92_Q	0.619	0.40
39_V	71_W	0.612	0.39
42_V	100_Y	0.610	0.39
14_V	28_N	0.610	0.39
72_N	84_S	0.609	0.39
91_N	101_C	0.607	0.39
15_F	22_G	0.605	0.39
17_S	49_T	0.603	0.39
45_S	71_W	0.598	0.38
87_R	92_Q	0.582	0.37
37_V	80_Q	0.580	0.37
96_F	100_Y	0.577	0.36
30_L	60_G	0.571	0.36
75_A	79_S	0.567	0.35
20_L	31_L	0.563	0.35
31_L	64_K	0.560	0.35
67_F	81_C	0.558	0.35
37_V	56_S	0.557	0.34
34_C	86_G	0.556	0.34
35_K	46_A	0.556	0.34
81_C	86_G	0.554	0.34
62_A	87_R	0.552	0.34
62_A	70_E	0.532	0.32
72_N	77_D	0.523	0.32
55_T	72_N	0.512	0.31
10_G	16_P	0.509	0.30
35_K	96_F	0.501	0.30
38_V	62_A	0.500	0.30

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1a3pA	1	0.2596	23.7	0.88	Contact Map
2rnlA	1	0.3462	16.8	0.888	Contact Map
1ioxA	1	0.3077	15.4	0.89	Contact Map
1haeA	1	0.3077	15.3	0.89	Contact Map
1egfA	1	0.2981	12.3	0.894	Contact Map
3ltfD	1	0.3077	10.4	0.898	Contact Map
1k36A	1	0.2885	8.6	0.902	Contact Map
1d0qA	2	0.5865	8.2	0.903	Contact Map
1nziA	2	0.8269	8	0.903	Contact Map
3u7uG	1	0.2981	7	0.905	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0054 seconds.