Cys_rich_CWC - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Cys_rich_CWC - Cysteine-rich CWC

PFAM:	PF14375	Sequences: CPRCGAPFECGAAAGGATGPCWCAEVPLSPELLARLPEARYKDCLCPACLR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	51 (46)
Sequences:	5983 (3986)
Seq/√Len:	587.6
META:	0.905

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
22_W	47_P	3.260	1.00
6_A	48_A	2.754	1.00
20_P	25_E	2.241	1.00
29_S	32_L	1.895	1.00
3_R	45_L	1.773	1.00
26_V	47_P	1.756	1.00
2_P	8_F	1.607	1.00
28_L	50_L	1.589	1.00
34_A	37_P	1.575	1.00
30_P	34_A	1.501	1.00
8_F	43_D	1.469	1.00
35_R	40_R	1.408	1.00
25_E	47_P	1.405	1.00
14_A	20_P	1.318	1.00
12_A	15_G	1.261	1.00
2_P	43_D	1.254	1.00
12_A	24_A	1.251	1.00
20_P	24_A	1.224	1.00
34_A	38_E	1.139	1.00
36_L	40_R	1.125	1.00
28_L	33_L	1.123	1.00
28_L	32_L	1.106	1.00
8_F	47_P	1.030	1.00
32_L	35_R	1.002	1.00
12_A	16_G	0.955	1.00
11_G	15_G	0.938	1.00
30_P	33_L	0.925	1.00
13_A	16_G	0.917	1.00
3_R	41_Y	0.905	1.00
1_C	4_C	0.888	1.00
32_L	50_L	0.883	1.00
35_R	38_E	0.863	1.00
35_R	42_K	0.858	1.00
33_L	36_L	0.833	1.00
11_G	14_A	0.792	1.00
46_C	49_C	0.788	1.00
11_G	24_A	0.786	1.00
9_E	13_A	0.780	1.00
16_G	24_A	0.772	1.00
31_E	35_R	0.764	1.00
5_G	38_E	0.755	1.00
9_E	14_A	0.752	1.00
32_L	36_L	0.749	1.00
29_S	33_L	0.747	1.00
9_E	47_P	0.734	1.00
33_L	37_P	0.728	1.00
23_C	44_C	0.728	1.00
13_A	43_D	0.725	1.00
3_R	35_R	0.697	1.00
15_G	22_W	0.696	1.00
37_P	42_K	0.689	1.00
3_R	8_F	0.684	1.00
2_P	41_Y	0.640	1.00
22_W	25_E	0.632	1.00
2_P	45_L	0.629	1.00
36_L	45_L	0.615	1.00
2_P	7_P	0.600	1.00
37_P	41_Y	0.598	1.00
44_C	49_C	0.587	1.00
5_G	10_C	0.576	1.00
26_V	45_L	0.565	1.00
36_L	41_Y	0.548	0.99
16_G	20_P	0.547	0.99
31_E	34_A	0.524	0.99
11_G	20_P	0.521	0.99
28_L	45_L	0.516	0.99
15_G	25_E	0.505	0.99
11_G	22_W	0.501	0.99
3_R	40_R	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2wnfA	1	0.1765	7.7	0.814	Contact Map
1s24A	1	0.3333	4.9	0.831	Contact Map
2y69F	1	0.2941	4.5	0.833	Contact Map
1v54F	2	0.3333	4.3	0.836	Contact Map
2v3bB	1	0.2941	4.2	0.836	Contact Map
3h2yA	1	0	3.1	0.846	Contact Map
1vx7a	1	0.8431	2.7	0.851	Contact Map
3t6pA	1	0.2941	2.6	0.851	Contact Map
2gmgA	1	0.6863	2.5	0.854	Contact Map
3u5eg	1	0.8431	2.4	0.854	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0044 seconds.