AAA_assoc - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

AAA_assoc - Domain associated at C-terminal with AAA

PFAM:	PF14363	Sequences: LPPELRDYLFSKLSRKLFSFFSPYLTIVIEEFDGRLKRNELYDAAEAYLSTKISPSTARRLKASKGKKSKSLVLSMDDNEEVTDEFEGVKLWWTLVC	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	97 (95)
Sequences:	1067 (759)
Seq/√Len:	77.9
META:	0.074

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
24_Y	92_W	4.351	1.00
29_I	45_A	4.120	1.00
12_K	15_R	3.203	1.00
11_S	15_R	2.484	1.00
28_V	77_D	2.158	1.00
29_I	47_A	2.082	1.00
18_F	46_E	2.013	1.00
41_L	72_L	1.960	1.00
22_S	31_E	1.929	1.00
50_S	73_V	1.910	1.00
42_Y	95_L	1.729	1.00
11_S	17_L	1.682	1.00
81_E	92_W	1.654	1.00
33_D	66_G	1.604	1.00
9_L	20_F	1.596	1.00
14_S	88_G	1.594	1.00
81_E	94_T	1.593	1.00
53_I	58_A	1.575	0.99
37_K	40_E	1.539	0.99
40_E	46_E	1.475	0.99
28_V	60_R	1.459	0.99
26_T	30_E	1.409	0.99
52_K	55_P	1.386	0.99
7_D	30_E	1.370	0.99
38_R	43_D	1.370	0.99
20_F	23_P	1.333	0.98
12_K	74_L	1.330	0.98
63_A	74_L	1.274	0.98
42_Y	69_S	1.249	0.97
29_I	90_K	1.225	0.97
2_P	6_R	1.223	0.97
77_D	80_E	1.197	0.97
3_P	42_Y	1.187	0.96
68_K	96_V	1.178	0.96
35_R	64_S	1.165	0.96
6_R	11_S	1.159	0.96
27_I	41_L	1.153	0.96
31_E	34_G	1.145	0.96
68_K	71_S	1.127	0.95
66_G	86_F	1.106	0.95
47_A	71_S	1.094	0.94
1_L	7_D	1.068	0.94
32_F	80_E	1.046	0.93
69_S	88_G	1.045	0.93
53_I	61_L	1.037	0.93
66_G	69_S	1.030	0.92
33_D	62_K	1.000	0.91
33_D	50_S	0.992	0.91
63_A	86_F	0.990	0.91
43_D	91_L	0.982	0.90
4_E	7_D	0.981	0.90
42_Y	94_T	0.975	0.90
10_F	14_S	0.969	0.90
83_T	92_W	0.958	0.89
41_L	64_S	0.957	0.89
25_L	61_L	0.942	0.89
1_L	4_E	0.939	0.88
56_S	60_R	0.938	0.88
48_Y	84_D	0.937	0.88
38_R	85_E	0.934	0.88
43_D	65_K	0.898	0.86
73_V	76_M	0.887	0.85
14_S	21_F	0.880	0.85
30_E	95_L	0.873	0.84
27_I	77_D	0.862	0.84
15_R	43_D	0.843	0.82
45_A	61_L	0.843	0.82
41_L	80_E	0.841	0.82
16_K	29_I	0.820	0.81
43_D	61_L	0.818	0.80
38_R	47_A	0.815	0.80
42_Y	73_V	0.815	0.80
26_T	29_I	0.796	0.79
4_E	8_Y	0.795	0.78
18_F	32_F	0.784	0.77
5_L	10_F	0.783	0.77
91_L	95_L	0.783	0.77
8_Y	26_T	0.774	0.77
27_I	64_S	0.774	0.77
56_S	90_K	0.774	0.77
32_F	38_R	0.764	0.76
59_R	78_D	0.762	0.75
25_L	76_M	0.762	0.75
9_L	78_D	0.761	0.75
69_S	83_T	0.755	0.75
47_A	50_S	0.751	0.74
56_S	86_F	0.725	0.72
21_F	32_F	0.725	0.72
30_E	52_K	0.723	0.72
27_I	47_A	0.721	0.71
17_L	83_T	0.719	0.71
60_R	77_D	0.716	0.71
3_P	6_R	0.704	0.70
8_Y	19_S	0.703	0.69
47_A	67_K	0.703	0.69
32_F	41_L	0.689	0.68
73_V	95_L	0.688	0.68
45_A	49_L	0.684	0.67
56_S	65_K	0.674	0.66
37_K	74_L	0.671	0.66
20_F	91_L	0.661	0.65
58_A	61_L	0.652	0.64
14_S	19_S	0.645	0.63
58_A	80_E	0.643	0.63
60_R	63_A	0.634	0.61
39_N	64_S	0.628	0.61
5_L	18_F	0.622	0.60
52_K	60_R	0.620	0.60
21_F	49_L	0.619	0.60
27_I	53_I	0.618	0.59
2_P	44_A	0.616	0.59
50_S	91_L	0.610	0.58
6_R	74_L	0.607	0.58
47_A	79_N	0.607	0.58
1_L	22_S	0.606	0.58
71_S	80_E	0.596	0.57
36_L	51_T	0.586	0.55
45_A	71_S	0.582	0.55
45_A	78_D	0.579	0.55
46_E	73_V	0.579	0.55
34_G	95_L	0.578	0.54
46_E	89_V	0.575	0.54
66_G	79_N	0.570	0.53
16_K	26_T	0.555	0.52
31_E	67_K	0.554	0.51
51_T	54_S	0.553	0.51
4_E	47_A	0.547	0.51
9_L	15_R	0.544	0.50
20_F	83_T	0.537	0.49
62_K	80_E	0.534	0.49
31_E	88_G	0.532	0.49
29_I	65_K	0.526	0.48
84_D	96_V	0.526	0.48
71_S	75_S	0.526	0.48
47_A	89_V	0.518	0.47
70_K	89_V	0.515	0.46
82_V	89_V	0.513	0.46
7_D	19_S	0.511	0.46
71_S	89_V	0.509	0.46
3_P	10_F	0.504	0.45
37_K	96_V	0.503	0.45
16_K	62_K	0.500	0.45

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3wcqA	1	0.4124	5.9	0.919	Contact Map
3kq4B	1	0.9588	5	0.922	Contact Map
2ve7C	1	0.9278	4.8	0.922	Contact Map
3hr0A	2	0.8866	4.8	0.922	Contact Map
2a1rA	2	0.2268	4.4	0.923	Contact Map
1mkyA	1	0.3402	4.4	0.924	Contact Map
2khuA	1	0.1753	4.1	0.925	Contact Map
1ve0A	3	0.9072	3.8	0.926	Contact Map
1i7hA	1	0.4021	3.8	0.926	Contact Map
4orlA	1	0.9485	3.8	0.926	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0048 seconds.