Abi_C - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Abi_C - Abortive infection C-terminus

PFAM:	PF14355	Sequences: PKLYKEVAKALNLAPSQHPDGAKGEEDIKRILGGLASIVQGLAELRNKYGDAHGRGGRNPGLSPRHARLAVNAAGTLATFLLE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	83 (81)
Sequences:	5635 (3755)
Seq/√Len:	417.2
META:	0.914

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
46_R	52_A	3.488	1.00
35_L	73_A	2.751	1.00
30_R	41_G	2.559	1.00
34_G	41_G	2.532	1.00
26_E	30_R	2.459	1.00
30_R	40_Q	2.375	1.00
72_N	76_T	2.245	1.00
6_E	10_A	1.938	1.00
31_I	41_G	1.923	1.00
34_G	37_S	1.887	1.00
4_Y	39_V	1.868	1.00
2_K	6_E	1.706	1.00
40_Q	44_E	1.685	1.00
5_K	36_A	1.677	1.00
27_D	44_E	1.670	1.00
4_Y	8_A	1.668	1.00
63_S	66_H	1.622	1.00
55_R	59_N	1.529	1.00
26_E	29_K	1.525	1.00
30_R	33_G	1.473	1.00
30_R	44_E	1.463	1.00
30_R	37_S	1.380	1.00
73_A	76_T	1.367	1.00
5_K	16_S	1.342	1.00
35_L	76_T	1.341	1.00
8_A	36_A	1.328	1.00
35_L	77_L	1.299	1.00
6_E	9_K	1.297	1.00
29_K	33_G	1.286	1.00
68_R	79_T	1.276	1.00
70_A	74_A	1.265	1.00
33_G	37_S	1.245	1.00
24_G	49_Y	1.237	1.00
5_K	9_K	1.236	1.00
14_A	17_Q	1.193	1.00
75_G	79_T	1.188	1.00
25_E	29_K	1.124	1.00
78_A	82_L	1.113	1.00
42_L	70_A	1.079	1.00
49_Y	62_L	1.050	1.00
75_G	78_A	1.041	1.00
44_E	48_K	1.019	1.00
7_V	10_A	1.003	1.00
13_L	80_F	0.995	1.00
40_Q	43_A	0.978	1.00
71_V	75_G	0.977	1.00
64_P	68_R	0.973	1.00
28_I	66_H	0.951	1.00
37_S	40_Q	0.917	1.00
72_N	79_T	0.902	1.00
77_L	81_L	0.896	1.00
34_G	38_I	0.893	1.00
33_G	36_A	0.891	1.00
27_D	47_N	0.865	1.00
27_D	34_G	0.858	1.00
36_A	40_Q	0.835	1.00
9_K	16_S	0.815	1.00
59_N	62_L	0.801	1.00
69_L	80_F	0.796	1.00
27_D	41_G	0.792	1.00
62_L	66_H	0.780	1.00
45_L	70_A	0.779	1.00
19_P	22_A	0.779	1.00
24_G	48_K	0.777	1.00
38_I	73_A	0.739	1.00
31_I	70_A	0.736	1.00
7_V	54_G	0.721	1.00
43_A	47_N	0.721	1.00
75_G	82_L	0.717	1.00
2_K	47_N	0.714	1.00
72_N	75_G	0.708	1.00
46_R	53_H	0.704	1.00
30_R	34_G	0.687	1.00
31_I	34_G	0.669	0.99
60_P	66_H	0.661	0.99
69_L	73_A	0.657	0.99
7_V	81_L	0.655	0.99
28_I	45_L	0.652	0.99
18_H	24_G	0.650	0.99
43_A	48_K	0.646	0.99
2_K	44_E	0.646	0.99
5_K	33_G	0.643	0.99
31_I	38_I	0.642	0.99
7_V	11_L	0.639	0.99
68_R	72_N	0.636	0.99
49_Y	55_R	0.635	0.99
66_H	80_F	0.634	0.99
36_A	77_L	0.625	0.99
35_L	38_I	0.621	0.99
2_K	14_A	0.620	0.99
46_R	50_G	0.615	0.99
66_H	74_A	0.609	0.99
12_N	17_Q	0.602	0.99
59_N	82_L	0.598	0.99
8_A	29_K	0.586	0.99
12_N	16_S	0.581	0.99
4_Y	77_L	0.575	0.98
58_R	61_G	0.574	0.98
22_A	28_I	0.572	0.98
44_E	47_N	0.563	0.98
51_D	75_G	0.562	0.98
17_Q	21_G	0.561	0.98
56_G	59_N	0.559	0.98
13_L	18_H	0.558	0.98
76_T	79_T	0.557	0.98
4_Y	7_V	0.548	0.98
31_I	69_L	0.548	0.98
56_G	60_P	0.547	0.98
6_E	11_L	0.547	0.98
41_G	44_E	0.545	0.98
16_S	57_G	0.543	0.98
69_L	76_T	0.536	0.98
61_G	66_H	0.533	0.98
55_R	58_R	0.528	0.97
47_N	53_H	0.525	0.97
21_G	25_E	0.523	0.97
47_N	52_A	0.510	0.97
3_L	67_A	0.505	0.97
12_N	18_H	0.505	0.97
18_H	25_E	0.504	0.97
58_R	62_L	0.500	0.96
17_Q	26_E	0.500	0.96

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3qupA	1	0.4096	22.4	0.848	Contact Map
4anjA	1	0.8193	19.1	0.852	Contact Map
4byfA	1	0.8916	14.6	0.86	Contact Map
4pa0A	1	0.9277	13.6	0.862	Contact Map
4l79A	1	0.8916	9.9	0.87	Contact Map
1kk8A	1	0.9036	9.3	0.872	Contact Map
2dfsA	2	0.8795	9.1	0.872	Contact Map
3ljxA	1	0.241	8.9	0.873	Contact Map
1g8xA	2	0.9157	8.8	0.873	Contact Map
1w9iA	1	0.8434	8.7	0.873	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0045 seconds.