PrcB_C - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PrcB_C - PrcB C-terminal

PFAM:	PF14343	Sequences: MVVAVFLGERPTGGYSIEITSVEETGDTLVVRVRETSPGPGCMVTQVLTYPYHLVKIE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	58 (56)
Sequences:	8065 (6207)
Seq/√Len:	829.4
META:	0.94

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
13_G	45_T	3.836	1.00
39_G	42_C	2.838	1.00
7_L	35_E	2.359	1.00
4_A	54_L	2.097	1.00
7_L	37_S	2.018	1.00
12_T	44_V	1.926	1.00
20_T	34_R	1.886	1.00
9_E	50_Y	1.831	1.00
7_L	10_R	1.809	1.00
9_E	48_L	1.597	1.00
21_S	32_R	1.485	1.00
12_T	46_Q	1.415	1.00
16_S	36_T	1.407	1.00
13_G	47_V	1.381	1.00
19_I	22_V	1.376	1.00
7_L	17_I	1.365	1.00
19_I	53_H	1.256	1.00
20_T	32_R	1.234	1.00
19_I	55_V	1.226	1.00
23_E	32_R	1.216	1.00
18_E	36_T	1.172	1.00
43_M	46_Q	1.103	1.00
18_E	34_R	1.098	1.00
25_T	30_V	1.094	1.00
13_G	44_V	1.093	1.00
6_F	52_Y	1.069	1.00
24_E	27_D	1.063	1.00
12_T	49_T	1.058	1.00
10_R	35_E	1.044	1.00
5_V	31_V	1.008	1.00
5_V	53_H	0.968	1.00
2_V	54_L	0.958	1.00
3_V	57_I	0.954	1.00
5_V	33_V	0.943	1.00
14_G	44_V	0.903	1.00
22_V	57_I	0.891	1.00
43_M	47_V	0.872	1.00
13_G	49_T	0.866	1.00
27_D	33_V	0.865	1.00
23_E	30_V	0.852	1.00
13_G	46_Q	0.846	1.00
5_V	17_I	0.846	1.00
10_R	49_T	0.838	1.00
22_V	55_V	0.830	1.00
11_P	48_L	0.821	1.00
22_V	29_L	0.810	1.00
8_G	50_Y	0.802	1.00
17_I	33_V	0.759	1.00
2_V	42_C	0.729	1.00
25_T	28_T	0.724	1.00
17_I	53_H	0.716	1.00
43_M	48_L	0.715	1.00
4_A	52_Y	0.687	1.00
5_V	19_I	0.683	1.00
6_F	50_Y	0.678	1.00
22_V	31_V	0.674	1.00
18_E	53_H	0.656	1.00
2_V	50_Y	0.655	1.00
53_H	56_K	0.653	1.00
6_F	54_L	0.648	1.00
17_I	35_E	0.642	1.00
15_Y	37_S	0.637	1.00
45_T	48_L	0.635	1.00
7_L	33_V	0.630	1.00
10_R	37_S	0.629	1.00
3_V	31_V	0.618	1.00
52_Y	56_K	0.604	1.00
33_V	52_Y	0.603	1.00
37_S	42_C	0.596	1.00
2_V	5_V	0.584	1.00
24_E	28_T	0.583	1.00
10_R	15_Y	0.568	1.00
13_G	43_M	0.564	1.00
38_P	41_G	0.564	1.00
2_V	6_F	0.563	1.00
2_V	56_K	0.561	1.00
12_T	48_L	0.552	1.00
24_E	29_L	0.540	1.00
38_P	44_V	0.535	1.00
52_Y	55_V	0.535	1.00
6_F	53_H	0.528	1.00
22_V	52_Y	0.521	1.00
29_L	35_E	0.508	1.00
25_T	29_L	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3nkhA	2	1	3.9	0.859	Contact Map
1a0pA	1	0.8966	3.4	0.863	Contact Map
2n0yB	1	0.4138	3.4	0.863	Contact Map
1okcA	1	0.569	3	0.867	Contact Map
2lckA	1	0.4828	2.8	0.868	Contact Map
2a3vA	3	0.9138	2.5	0.873	Contact Map
2y35A	1	0.6897	2.4	0.873	Contact Map
3izxD	1	0.8621	2.4	0.874	Contact Map
4h3wA	1	0.9138	2.4	0.874	Contact Map
2ijrA	1	0.9483	2.3	0.875	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0043 seconds.