PilX_N - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PilX_N - PilX N-terminal

PFAM:	PF14341	Sequences: RGAALVVALLLLLVLTLLGVAAMRTSTLEERMAGNYRDRQQAFYAAEAGLE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	51 (50)
Sequences:	14628 (9635)
Seq/√Len:	1362.6
META:	0.949

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
37_R	41_Q	2.446	1.00
16_T	20_V	2.363	1.00
36_Y	40_Q	2.309	1.00
3_A	7_V	2.278	1.00
38_D	41_Q	1.986	1.00
23_M	27_T	1.840	1.00
38_D	42_A	1.673	1.00
24_R	27_T	1.604	1.00
30_E	34_G	1.573	1.00
36_Y	39_R	1.519	1.00
28_L	32_M	1.451	1.00
34_G	38_D	1.421	1.00
25_T	28_L	1.380	1.00
30_E	37_R	1.369	1.00
28_L	35_N	1.343	1.00
41_Q	45_A	1.343	1.00
40_Q	44_Y	1.322	1.00
11_L	15_L	1.196	1.00
39_R	43_F	1.174	1.00
3_A	6_V	1.168	1.00
20_V	23_M	1.154	1.00
13_L	16_T	1.121	1.00
39_R	42_A	1.111	1.00
27_T	31_R	1.102	1.00
9_L	13_L	1.097	1.00
34_G	37_R	1.091	1.00
25_T	29_E	1.062	1.00
12_L	16_T	1.049	1.00
6_V	9_L	1.026	1.00
8_A	12_L	1.001	1.00
5_L	9_L	0.990	1.00
29_E	36_Y	0.971	1.00
29_E	32_M	0.964	1.00
42_A	45_A	0.957	1.00
43_F	47_E	0.941	1.00
19_G	23_M	0.935	1.00
40_Q	43_F	0.911	1.00
42_A	46_A	0.861	1.00
21_A	24_R	0.840	1.00
27_T	30_E	0.833	1.00
4_A	8_A	0.804	1.00
32_M	35_N	0.800	1.00
46_A	49_G	0.770	1.00
6_V	10_L	0.766	1.00
24_R	28_L	0.760	1.00
9_L	12_L	0.759	1.00
41_Q	44_Y	0.744	1.00
4_A	7_V	0.735	1.00
20_V	24_R	0.700	1.00
7_V	11_L	0.696	1.00
21_A	25_T	0.668	1.00
5_L	33_A	0.666	1.00
47_E	50_L	0.666	1.00
33_A	36_Y	0.662	1.00
15_L	22_A	0.654	1.00
23_M	26_S	0.643	1.00
11_L	14_V	0.641	1.00
17_L	25_T	0.639	1.00
11_L	32_M	0.639	1.00
42_A	50_L	0.620	1.00
17_L	21_A	0.611	1.00
37_R	40_Q	0.606	1.00
4_A	42_A	0.593	1.00
22_A	26_S	0.576	1.00
12_L	15_L	0.550	1.00
37_R	47_E	0.546	1.00
31_R	34_G	0.546	1.00
43_F	48_A	0.540	1.00
10_L	14_V	0.534	1.00
12_L	19_G	0.530	1.00
19_G	48_A	0.527	1.00
33_A	47_E	0.516	1.00
2_G	5_L	0.513	1.00
2_G	8_A	0.504	1.00
18_L	21_A	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4c7rA	3	1	16	0.756	Contact Map
3ci0K	1	0.4118	15.5	0.757	Contact Map
1oqwA	1	0.9608	3.5	0.821	Contact Map
2hi2A	1	0.8627	3.1	0.825	Contact Map
4ut1A	1	0	2.7	0.831	Contact Map
4gdxA	1	0.4706	2.3	0.837	Contact Map
3sokA	1	0.8824	2.2	0.839	Contact Map
3whrA	1	0.4314	2.1	0.84	Contact Map
3j0fE	4	0.451	1.8	0.845	Contact Map
4he8J	1	0.5294	1.8	0.846	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0043 seconds.