Zn_Tnp_IS91 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Zn_Tnp_IS91 - Transposase zinc-binding domain

PFAM:	PF14319	Sequences: DIFRRHGPAYRARHGGRLSPSQRKVLRAILRCRTAALGGHVYRCDDCGHERIVYNSCRNRHCPKCQGLARARWLEARQAELLPVPYFHVVFTLPHELRPLALQNQRLLY	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	109 (108)
Sequences:	27913 (13846)
Seq/√Len:	1332.3
META:	0.981

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
77_R	80_E	3.225	1.00
28_A	59_N	3.102	1.00
101_A	108_L	3.011	1.00
40_H	55_N	2.946	1.00
31_R	37_L	2.633	1.00
19_S	22_Q	2.577	1.00
43_R	50_E	2.543	1.00
95_H	98_R	2.525	1.00
42_Y	51_R	2.280	1.00
67_G	71_A	2.118	1.00
41_V	50_E	2.117	1.00
93_L	101_A	2.050	1.00
41_V	52_I	2.014	1.00
3_F	26_L	1.940	1.00
27_R	31_R	1.929	1.00
7_G	26_L	1.856	1.00
26_L	30_L	1.807	1.00
68_L	72_R	1.783	1.00
23_R	27_R	1.728	1.00
42_Y	53_V	1.655	1.00
11_R	23_R	1.651	1.00
31_R	36_A	1.645	1.00
10_Y	14_H	1.613	1.00
75_E	78_Q	1.554	1.00
43_R	48_G	1.530	1.00
24_K	28_A	1.446	1.00
82_L	86_Y	1.417	1.00
4_R	30_L	1.402	1.00
25_V	59_N	1.395	1.00
33_R	64_K	1.395	1.00
7_G	11_R	1.367	1.00
35_A	54_Y	1.347	1.00
39_G	52_I	1.324	1.00
102_L	105_Q	1.237	1.00
34_T	37_L	1.217	1.00
7_G	30_L	1.178	1.00
69_A	72_R	1.167	1.00
3_F	29_I	1.145	1.00
62_C	65_C	1.122	1.00
57_C	62_C	1.120	1.00
39_G	54_Y	1.118	1.00
99_P	103_Q	1.108	1.00
25_V	61_H	1.086	1.00
67_G	70_R	1.077	1.00
44_C	47_C	1.069	1.00
8_P	12_A	1.059	1.00
33_R	56_S	1.013	1.00
22_Q	105_Q	1.007	1.00
10_Y	18_L	1.000	1.00
72_R	76_A	0.994	1.00
93_L	108_L	0.982	1.00
98_R	101_A	0.971	1.00
40_H	53_V	0.969	1.00
7_G	10_Y	0.965	1.00
11_R	30_L	0.955	1.00
9_A	12_A	0.953	1.00
52_I	55_N	0.947	1.00
21_S	25_V	0.945	1.00
104_N	107_L	0.941	1.00
9_A	13_R	0.934	1.00
18_L	23_R	0.933	1.00
53_V	64_K	0.930	1.00
96_E	99_P	0.929	1.00
68_L	71_A	0.926	1.00
20_P	23_R	0.911	1.00
71_A	75_E	0.902	1.00
3_F	30_L	0.896	1.00
58_R	69_A	0.876	1.00
74_L	78_Q	0.855	1.00
20_P	24_K	0.846	1.00
70_R	74_L	0.841	1.00
76_A	80_E	0.832	1.00
14_H	18_L	0.831	1.00
66_Q	70_R	0.830	1.00
34_T	54_Y	0.830	1.00
57_C	60_R	0.829	1.00
98_R	102_L	0.811	1.00
101_A	105_Q	0.811	1.00
11_R	18_L	0.802	1.00
27_R	30_L	0.802	1.00
2_I	6_H	0.801	1.00
78_Q	81_L	0.799	1.00
93_L	98_R	0.787	1.00
76_A	79_A	0.786	1.00
11_R	26_L	0.784	1.00
66_Q	69_A	0.779	1.00
6_H	9_A	0.777	1.00
18_L	22_Q	0.776	1.00
28_A	31_R	0.774	1.00
105_Q	109_Y	0.754	1.00
100_L	104_N	0.748	1.00
42_Y	49_H	0.740	1.00
57_C	65_C	0.737	1.00
95_H	99_P	0.732	1.00
43_R	49_H	0.732	1.00
78_Q	83_P	0.725	1.00
71_A	78_Q	0.721	1.00
21_S	59_N	0.716	1.00
11_R	15_G	0.716	1.00
39_G	55_N	0.700	1.00
71_A	74_L	0.698	1.00
22_Q	25_V	0.696	1.00
35_A	52_I	0.693	1.00
93_L	97_L	0.689	1.00
31_R	34_T	0.682	1.00
75_E	79_A	0.679	1.00
14_H	17_R	0.679	1.00
100_L	108_L	0.678	1.00
21_S	24_K	0.674	1.00
56_S	64_K	0.673	1.00
40_H	52_I	0.664	1.00
61_H	66_Q	0.659	1.00
35_A	39_G	0.653	1.00
18_L	26_L	0.653	1.00
29_I	63_P	0.646	1.00
99_P	102_L	0.643	1.00
98_R	103_Q	0.641	1.00
8_P	11_R	0.634	1.00
5_R	8_P	0.621	1.00
101_A	109_Y	0.620	1.00
70_R	80_E	0.616	1.00
21_S	105_Q	0.614	1.00
15_G	23_R	0.614	1.00
6_H	10_Y	0.607	1.00
4_R	7_G	0.607	1.00
72_R	75_E	0.605	1.00
8_P	30_L	0.599	1.00
58_R	66_Q	0.595	1.00
5_R	9_A	0.589	1.00
76_A	81_L	0.579	1.00
3_F	10_Y	0.577	1.00
74_L	77_R	0.577	1.00
15_G	18_L	0.577	1.00
23_R	30_L	0.576	1.00
12_A	15_G	0.561	1.00
49_H	52_I	0.559	1.00
7_G	18_L	0.556	1.00
20_P	27_R	0.555	1.00
7_G	23_R	0.555	1.00
89_V	92_T	0.551	1.00
33_R	54_Y	0.548	1.00
23_R	26_L	0.547	1.00
7_G	14_H	0.545	1.00
4_R	8_P	0.543	1.00
29_I	34_T	0.540	1.00
3_F	7_G	0.539	1.00
60_R	65_C	0.536	1.00
55_N	58_R	0.533	1.00
100_L	103_Q	0.532	1.00
11_R	14_H	0.529	1.00
19_S	23_R	0.527	1.00
46_D	49_H	0.522	1.00
25_V	29_I	0.521	1.00
3_F	6_H	0.519	1.00
95_H	102_L	0.518	1.00
77_R	82_L	0.518	1.00
48_G	51_R	0.515	1.00
73_W	76_A	0.506	1.00
80_E	90_V	0.505	1.00
98_R	105_Q	0.501	1.00
92_T	95_H	0.501	1.00
54_Y	64_K	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4qiwP	1	0.3761	58.7	0.878	Contact Map
1gh9A	1	0.5413	58.7	0.878	Contact Map
1yuzA	2	0.578	49.3	0.884	Contact Map
4ce45	1	0.4404	49.2	0.884	Contact Map
4aybP	1	0.3853	45.8	0.886	Contact Map
1vq8Z	1	0.6697	44	0.888	Contact Map
3pwfA	4	0.6147	36.5	0.893	Contact Map
1lkoA	3	0.6606	30.8	0.897	Contact Map
2lcqA	1	0.6789	30.7	0.897	Contact Map
1vw4W	1	0.6972	26.5	0.9	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0051 seconds.