DUF4372 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF4372 - Domain of unknown function (DUF4372)

PFAM:	PF14294	Sequences: HGKTVFSQLLDLLPRHEFDRLVKRYGGDRYVRSFSCWDQFVAMLFAQLTGRESLRDIEACLRAHSGKLYHLGIR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	74 (72)
Sequences:	19671 (8056)
Seq/√Len:	949.4
META:	0.982

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
35_S	38_D	3.062	1.00
15_R	37_W	3.052	1.00
37_W	41_V	2.433	1.00
10_L	41_V	2.293	1.00
27_G	36_C	2.150	1.00
15_R	19_D	2.109	1.00
26_G	29_R	2.054	1.00
10_L	44_L	1.953	1.00
17_E	20_R	1.873	1.00
3_K	11_D	1.852	1.00
16_H	20_R	1.687	1.00
28_D	36_C	1.525	1.00
40_F	44_L	1.510	1.00
64_H	67_K	1.486	1.00
45_F	60_C	1.402	1.00
17_E	21_L	1.381	1.00
3_K	7_S	1.371	1.00
51_R	56_D	1.362	1.00
18_F	22_V	1.335	1.00
31_V	36_C	1.331	1.00
19_D	23_K	1.317	1.00
34_F	42_A	1.275	1.00
8_Q	11_D	1.253	1.00
28_D	31_V	1.246	1.00
22_V	36_C	1.240	1.00
16_H	19_D	1.239	1.00
14_P	17_E	1.237	1.00
18_F	37_W	1.229	1.00
36_C	39_Q	1.203	1.00
7_S	11_D	1.202	1.00
13_L	40_F	1.119	1.00
61_L	68_L	1.095	1.00
58_E	62_R	1.089	1.00
62_R	65_S	1.050	1.00
21_L	24_R	1.023	1.00
31_V	35_S	0.995	1.00
64_H	71_L	0.979	1.00
46_A	57_I	0.969	1.00
31_V	34_F	0.962	1.00
21_L	25_Y	0.956	1.00
41_V	73_I	0.950	1.00
38_D	73_I	0.946	1.00
62_R	68_L	0.934	1.00
4_T	71_L	0.932	1.00
18_F	40_F	0.926	1.00
39_Q	43_M	0.921	1.00
34_F	38_D	0.919	1.00
19_D	37_W	0.913	1.00
29_R	32_R	0.892	1.00
61_L	73_I	0.891	1.00
52_E	56_D	0.880	1.00
6_F	45_F	0.877	1.00
18_F	36_C	0.874	1.00
68_L	73_I	0.860	1.00
51_R	57_I	0.841	1.00
42_A	73_I	0.838	1.00
22_V	27_G	0.826	1.00
54_L	58_E	0.824	1.00
20_R	23_K	0.792	1.00
9_L	48_L	0.780	1.00
6_F	41_V	0.771	1.00
27_G	31_V	0.761	1.00
34_F	45_F	0.757	1.00
45_F	49_T	0.740	1.00
21_L	27_G	0.731	1.00
66_G	69_Y	0.719	1.00
42_A	46_A	0.717	1.00
10_L	37_W	0.710	1.00
30_Y	36_C	0.709	1.00
19_D	28_D	0.707	1.00
56_D	59_A	0.706	1.00
30_Y	33_S	0.702	1.00
28_D	32_R	0.701	1.00
46_A	54_L	0.692	1.00
59_A	62_R	0.692	1.00
20_R	24_R	0.682	1.00
39_Q	54_L	0.662	1.00
4_T	46_A	0.660	1.00
44_L	48_L	0.658	1.00
63_A	69_Y	0.657	1.00
22_V	28_D	0.637	1.00
15_R	20_R	0.635	1.00
51_R	60_C	0.633	1.00
65_S	68_L	0.631	1.00
13_L	17_E	0.628	1.00
42_A	61_L	0.626	1.00
53_S	56_D	0.625	1.00
13_L	37_W	0.623	1.00
47_Q	58_E	0.618	1.00
26_G	31_V	0.618	1.00
43_M	46_A	0.616	1.00
47_Q	57_I	0.600	1.00
2_G	7_S	0.599	1.00
8_Q	12_L	0.597	1.00
64_H	68_L	0.596	1.00
55_R	58_E	0.590	1.00
65_S	69_Y	0.588	1.00
59_A	63_A	0.569	1.00
50_G	56_D	0.563	1.00
5_V	8_Q	0.550	1.00
60_C	68_L	0.546	1.00
33_S	54_L	0.542	1.00
56_D	60_C	0.536	1.00
49_T	52_E	0.530	1.00
45_F	61_L	0.526	1.00
14_P	19_D	0.518	1.00
26_G	36_C	0.509	1.00
10_L	15_R	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4mzzA	1	0.3108	4.8	0.895	Contact Map
4hrrA	1	0.9865	3.2	0.904	Contact Map
3doeB	1	0.4054	3.1	0.905	Contact Map
1vzmA	1	0.4189	3.1	0.905	Contact Map
5agaA	4	1	2.7	0.907	Contact Map
4jrbA	1	0.8784	2.7	0.907	Contact Map
1q8hA	2	0.3649	2.4	0.91	Contact Map
3g46A	2	0.9865	2.1	0.913	Contact Map
3qxlA	1	0.9865	2.1	0.913	Contact Map
2v6eA	2	1	2	0.914	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0048 seconds.