YWFCY - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YWFCY - YWFCY protein

PFAM:	PF14293	Sequences: QTGENEQGLRKILDFTRLISILILLLHFYYYCYGAFKEWGLTSGITDRILLNIQRTAGLF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	60 (59)
Sequences:	1503 (868)
Seq/√Len:	113.0
META:	0.881

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
15_F	19_I	3.785	1.00
35_A	39_W	3.605	1.00
43_S	46_T	2.958	1.00
34_G	37_K	2.810	1.00
33_Y	47_D	2.595	1.00
3_G	10_R	2.434	1.00
21_I	25_L	2.305	1.00
36_F	42_T	2.010	1.00
15_F	18_L	1.949	1.00
1_Q	6_E	1.596	1.00
13_L	16_T	1.548	1.00
44_G	48_R	1.495	1.00
10_R	14_D	1.489	1.00
8_G	45_I	1.434	1.00
46_T	50_L	1.322	1.00
36_F	46_T	1.215	0.99
56_T	59_L	1.199	0.99
1_Q	10_R	1.182	0.99
1_Q	8_G	1.181	0.99
3_G	6_E	1.134	0.99
48_R	51_L	1.095	0.98
53_I	56_T	1.065	0.98
14_D	24_L	1.059	0.98
6_E	10_R	1.057	0.98
42_T	46_T	1.052	0.98
33_Y	50_L	1.051	0.98
37_K	42_T	1.044	0.98
35_A	38_E	1.024	0.97
39_W	43_S	0.971	0.96
8_G	12_I	0.964	0.96
37_K	47_D	0.922	0.95
12_I	23_I	0.922	0.95
7_Q	10_R	0.916	0.95
26_L	30_Y	0.894	0.94
19_I	22_L	0.884	0.94
8_G	16_T	0.883	0.94
13_L	17_R	0.882	0.94
30_Y	54_Q	0.854	0.93
32_C	35_A	0.839	0.92
51_L	55_R	0.836	0.92
11_K	17_R	0.818	0.91
7_Q	19_I	0.799	0.90
35_A	41_L	0.793	0.89
24_L	36_F	0.791	0.89
25_L	34_G	0.790	0.89
1_Q	34_G	0.782	0.89
30_Y	50_L	0.739	0.86
3_G	7_Q	0.738	0.86
2_T	6_E	0.729	0.85
13_L	28_F	0.718	0.84
23_I	51_L	0.698	0.83
48_R	52_N	0.691	0.82
17_R	20_S	0.661	0.79
15_F	25_L	0.650	0.78
33_Y	42_T	0.649	0.78
24_L	35_A	0.639	0.77
44_G	51_L	0.633	0.76
34_G	51_L	0.630	0.76
29_Y	36_F	0.624	0.75
45_I	48_R	0.624	0.75
2_T	10_R	0.616	0.74
20_S	60_F	0.615	0.74
6_E	30_Y	0.605	0.73
38_E	44_G	0.603	0.73
18_L	22_L	0.595	0.72
38_E	55_R	0.592	0.71
18_L	47_D	0.576	0.69
16_T	23_I	0.568	0.68
2_T	27_H	0.557	0.67
52_N	56_T	0.555	0.66
4_E	10_R	0.550	0.66
24_L	27_H	0.547	0.65
29_Y	55_R	0.546	0.65
52_N	58_G	0.539	0.64
14_D	17_R	0.537	0.64
37_K	51_L	0.534	0.63
2_T	14_D	0.534	0.63
37_K	40_G	0.532	0.63
13_L	25_L	0.532	0.63
26_L	60_F	0.523	0.62
51_L	54_Q	0.519	0.61
24_L	40_G	0.519	0.61
46_T	49_I	0.519	0.61
6_E	31_Y	0.515	0.61
24_L	44_G	0.511	0.60
28_F	35_A	0.501	0.58
36_F	39_W	0.501	0.58
33_Y	36_F	0.500	0.58

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4n7bA	1	0	7.7	0.894	Contact Map
3dkxA	3	0.9333	6.1	0.899	Contact Map
4f8xA	1	0.9667	6	0.899	Contact Map
4ha4A	4	0.95	5.9	0.9	Contact Map
2bs2C	2	1	5.3	0.902	Contact Map
1xyzA	1	0.9667	4.5	0.905	Contact Map
2xfrA	1	0.9833	4.2	0.906	Contact Map
4j7cI	2	1	4	0.907	Contact Map
3vx8D	1	1	3.9	0.907	Contact Map
4f9dA	1	0.95	3.9	0.908	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.