DUF4369 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF4369 - Domain of unknown function (DUF4369)

PFAM:	PF14289	Sequences: CLASCCAKKNGFTIKGTIKGLKDGTVYLLKYDGNGLVVIDSAKVKNGKFSFKGKVDEPGFYYLRLDNKKGYIPFFLENGKITITGDADDLAKVTGSKENDLF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	102 (97)
Sequences:	24420 (20024)
Seq/√Len:	2033.1
META:	0.919

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
12_F	53_G	3.876	1.00
16_G	49_F	3.313	1.00
13_T	50_S	2.677	1.00
17_T	48_K	2.637	1.00
42_A	51_F	2.405	1.00
15_K	50_S	2.273	1.00
98_E	101_L	2.254	1.00
17_T	84_T	2.129	1.00
13_T	52_K	2.086	1.00
26_V	43_K	1.985	1.00
15_K	80_K	1.970	1.00
15_K	82_T	1.900	1.00
13_T	80_K	1.805	1.00
82_T	94_T	1.794	1.00
25_T	43_K	1.772	1.00
77_E	98_E	1.707	1.00
97_K	100_D	1.636	1.00
18_I	85_G	1.633	1.00
84_T	92_K	1.626	1.00
97_K	101_L	1.550	1.00
19_K	86_D	1.537	1.00
86_D	89_D	1.535	1.00
15_K	48_K	1.474	1.00
42_A	49_F	1.472	1.00
29_L	64_R	1.460	1.00
73_P	76_L	1.421	1.00
72_I	91_A	1.378	1.00
96_S	99_N	1.345	1.00
76_L	79_G	1.314	1.00
61_Y	76_L	1.271	1.00
26_V	41_S	1.227	1.00
11_G	52_K	1.191	1.00
85_G	91_A	1.180	1.00
81_I	85_G	1.147	1.00
85_G	90_L	1.140	1.00
19_K	84_T	1.124	1.00
62_Y	73_P	1.107	1.00
75_F	98_E	1.097	1.00
44_V	49_F	1.067	1.00
30_K	37_V	1.063	1.00
11_G	54_K	1.056	1.00
29_L	38_V	1.055	1.00
60_F	64_R	1.042	1.00
5_C	8_K	1.041	1.00
29_L	32_D	1.041	1.00
53_G	76_L	1.034	1.00
84_T	94_T	1.031	1.00
20_G	86_D	1.009	1.00
81_I	96_S	0.981	1.00
30_K	39_I	0.975	1.00
96_S	100_D	0.962	1.00
28_L	40_D	0.959	1.00
29_L	33_G	0.959	1.00
82_T	85_G	0.949	1.00
60_F	73_P	0.925	1.00
75_F	99_N	0.905	1.00
21_L	24_G	0.904	1.00
30_K	59_G	0.902	1.00
30_K	33_G	0.896	1.00
77_E	96_S	0.887	1.00
37_V	40_D	0.883	1.00
11_G	78_N	0.875	1.00
25_T	41_S	0.871	1.00
77_E	81_I	0.869	1.00
10_N	54_K	0.857	1.00
74_F	99_N	0.855	1.00
91_A	99_N	0.841	1.00
59_G	62_Y	0.829	1.00
41_S	51_F	0.826	1.00
94_T	100_D	0.814	1.00
27_Y	41_S	0.812	1.00
21_L	44_V	0.809	1.00
40_D	43_K	0.809	1.00
13_T	16_G	0.804	1.00
26_V	29_L	0.804	1.00
25_T	66_D	0.801	1.00
87_A	90_L	0.794	1.00
8_K	11_G	0.786	1.00
14_I	81_I	0.786	1.00
12_F	55_V	0.780	1.00
6_C	9_K	0.777	1.00
27_Y	40_D	0.771	1.00
38_V	41_S	0.767	1.00
95_G	99_N	0.760	1.00
22_K	25_T	0.758	1.00
93_V	96_S	0.757	1.00
62_Y	70_G	0.753	1.00
31_Y	36_L	0.745	1.00
28_L	41_S	0.735	1.00
64_R	71_Y	0.734	1.00
49_F	85_G	0.724	1.00
45_K	48_K	0.716	1.00
31_Y	35_G	0.713	1.00
62_Y	71_Y	0.710	1.00
79_G	96_S	0.708	1.00
93_V	99_N	0.706	1.00
60_F	66_D	0.698	1.00
16_G	44_V	0.693	1.00
12_F	76_L	0.691	1.00
33_G	36_L	0.691	1.00
32_D	37_V	0.689	1.00
66_D	70_G	0.688	1.00
74_F	83_I	0.687	1.00
74_F	77_E	0.680	1.00
7_A	10_N	0.679	1.00
63_L	66_D	0.666	1.00
18_I	21_L	0.660	1.00
67_N	70_G	0.652	1.00
7_A	11_G	0.649	1.00
17_T	82_T	0.641	1.00
25_T	28_L	0.640	1.00
59_G	63_L	0.623	1.00
86_D	91_A	0.614	1.00
24_G	28_L	0.607	1.00
29_L	36_L	0.604	1.00
32_D	36_L	0.599	1.00
23_D	43_K	0.595	1.00
20_G	87_A	0.594	1.00
60_F	75_F	0.593	1.00
19_K	47_G	0.584	1.00
55_V	59_G	0.578	1.00
32_D	35_G	0.574	1.00
35_G	38_V	0.569	1.00
10_N	78_N	0.567	1.00
22_K	44_V	0.567	1.00
55_V	76_L	0.556	1.00
58_P	76_L	0.555	1.00
24_G	43_K	0.555	1.00
23_D	45_K	0.554	1.00
24_G	66_D	0.554	1.00
21_L	85_G	0.547	1.00
11_G	53_G	0.546	1.00
55_V	58_P	0.544	1.00
55_V	78_N	0.542	1.00
62_Y	66_D	0.541	1.00
72_I	76_L	0.539	1.00
64_R	67_N	0.534	1.00
86_D	90_L	0.530	1.00
61_Y	65_L	0.525	1.00
39_I	61_Y	0.523	1.00
20_G	47_G	0.523	1.00
49_F	84_T	0.515	1.00
59_G	76_L	0.509	1.00
23_D	27_Y	0.507	1.00
60_F	65_L	0.502	1.00
83_I	91_A	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4u3sB	1	0.8725	30.4	0.842	Contact Map
1uwyA	1	0.8725	10.6	0.872	Contact Map
1h8lA	1	0.8137	6.9	0.882	Contact Map
3qcwA	1	0	6.6	0.883	Contact Map
2nsmA	1	0.8137	6.1	0.885	Contact Map
4eibA	2	0.6667	6	0.885	Contact Map
3ecqA	1	0.9412	5.4	0.888	Contact Map
3w5fA	1	0.4608	5.1	0.889	Contact Map
4kdwA	1	0.8039	5	0.89	Contact Map
3uafA	2	0.8431	4.7	0.891	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0051 seconds.