FKS1_dom1 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FKS1_dom1 - 1,3-beta-glucan synthase subunit FKS1, domain-1

PFAM:	PF14288	Sequences: QRLLQIALYLLIWGEAANLRFMPECLCFIFHCMADYLNSELQGRLEPEGSFLDNVITPIYRVIRDQEYEISKGGEADHSAWRNYDDFNELFWSPECFERLGWP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	103 (101)
Sequences:	758 (384)
Seq/√Len:	38.2
META:	0.253

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
19_L	56_I	5.262	1.00
22_M	25_C	3.288	1.00
16_A	56_I	2.934	1.00
63_I	87_F	2.845	1.00
90_L	96_C	2.570	1.00
93_S	96_C	2.013	0.99
42_Q	45_L	1.956	0.98
27_C	92_W	1.884	0.98
28_F	32_C	1.825	0.98
41_L	44_R	1.788	0.97
13_W	78_H	1.770	0.97
12_I	51_F	1.688	0.96
73_G	80_A	1.641	0.95
20_R	24_E	1.602	0.95
85_D	88_N	1.595	0.95
94_P	100_L	1.543	0.94
39_S	42_Q	1.522	0.93
17_A	57_T	1.505	0.93
22_M	87_F	1.504	0.93
10_L	19_L	1.489	0.92
24_E	27_C	1.485	0.92
10_L	13_W	1.458	0.92
27_C	31_H	1.452	0.91
14_G	52_L	1.451	0.91
64_R	67_E	1.451	0.91
33_M	83_N	1.419	0.90
40_E	45_L	1.406	0.90
8_L	83_N	1.394	0.90
66_Q	70_I	1.392	0.90
98_E	101_G	1.372	0.89
49_G	57_T	1.348	0.88
40_E	44_R	1.338	0.88
52_L	60_Y	1.325	0.87
47_P	54_N	1.270	0.85
33_M	36_Y	1.239	0.83
39_S	44_R	1.232	0.83
42_Q	46_E	1.201	0.81
14_G	92_W	1.176	0.80
52_L	55_V	1.169	0.79
12_I	17_A	1.119	0.76
10_L	14_G	1.110	0.76
18_N	89_E	1.098	0.75
78_H	82_R	1.097	0.75
47_P	53_D	1.096	0.75
21_F	81_W	1.092	0.75
40_E	43_G	1.091	0.74
62_V	82_R	1.078	0.74
48_E	90_L	1.070	0.73
64_R	68_Y	1.048	0.71
83_N	89_E	1.045	0.71
5_Q	21_F	1.028	0.70
23_P	30_F	1.006	0.68
71_S	74_G	1.005	0.68
9_Y	12_I	1.005	0.68
49_G	54_N	0.987	0.67
22_M	63_I	0.986	0.67
6_I	62_V	0.973	0.66
13_W	16_A	0.972	0.66
34_A	37_L	0.971	0.65
57_T	70_I	0.954	0.64
60_Y	91_F	0.947	0.64
14_G	91_F	0.930	0.62
2_R	101_G	0.923	0.62
41_L	45_L	0.921	0.61
78_H	91_F	0.913	0.61
77_D	100_L	0.893	0.59
32_C	96_C	0.880	0.58
94_P	99_R	0.874	0.57
2_R	34_A	0.861	0.56
26_L	66_Q	0.852	0.55
8_L	33_M	0.843	0.55
43_G	46_E	0.839	0.54
16_A	26_L	0.837	0.54
50_S	54_N	0.829	0.53
78_H	92_W	0.824	0.53
2_R	22_M	0.824	0.53
62_V	83_N	0.805	0.51
15_E	20_R	0.804	0.51
78_H	83_N	0.803	0.51
53_D	57_T	0.801	0.51
66_Q	87_F	0.790	0.50
23_P	27_C	0.788	0.50
17_A	89_E	0.781	0.49
69_E	73_G	0.778	0.49
90_L	97_F	0.770	0.48
3_L	57_T	0.769	0.48
25_C	100_L	0.759	0.47
83_N	96_C	0.757	0.47
71_S	76_A	0.753	0.46
14_G	78_H	0.749	0.46
13_W	52_L	0.745	0.46
12_I	26_L	0.744	0.46
7_A	77_D	0.743	0.46
10_L	52_L	0.733	0.45
33_M	82_R	0.729	0.44
10_L	25_C	0.723	0.44
97_F	102_W	0.720	0.44
65_D	68_Y	0.715	0.43
14_G	27_C	0.705	0.42
12_I	78_H	0.699	0.42
89_E	102_W	0.696	0.41
41_L	46_E	0.687	0.41
32_C	83_N	0.682	0.40
86_D	91_F	0.670	0.39
24_E	28_F	0.666	0.39
78_H	84_Y	0.656	0.38
9_Y	96_C	0.652	0.38
73_G	76_A	0.651	0.38
68_Y	75_E	0.650	0.38
21_F	83_N	0.650	0.38
25_C	29_I	0.645	0.37
40_E	46_E	0.645	0.37
10_L	60_Y	0.637	0.36
8_L	12_I	0.633	0.36
81_W	89_E	0.609	0.34
93_S	98_E	0.602	0.34
4_L	101_G	0.601	0.34
3_L	11_L	0.592	0.33
4_L	7_A	0.592	0.33
11_L	18_N	0.591	0.33
37_L	53_D	0.588	0.32
30_F	34_A	0.588	0.32
26_L	69_E	0.585	0.32
23_P	33_M	0.583	0.32
9_Y	16_A	0.582	0.32
25_C	28_F	0.581	0.32
17_A	38_N	0.578	0.32
19_L	61_R	0.572	0.31
20_R	23_P	0.572	0.31
12_I	96_C	0.567	0.31
95_E	101_G	0.566	0.31
17_A	77_D	0.563	0.31
21_F	25_C	0.555	0.30
13_W	91_F	0.553	0.30
31_H	89_E	0.542	0.29
24_E	31_H	0.539	0.29
44_R	47_P	0.536	0.29
17_A	97_F	0.535	0.28
36_Y	81_W	0.531	0.28
41_L	51_F	0.528	0.28
62_V	89_E	0.527	0.28
92_W	96_C	0.526	0.28
2_R	49_G	0.526	0.28
22_M	38_N	0.525	0.28
50_S	71_S	0.522	0.28
49_G	53_D	0.514	0.27
50_S	53_D	0.512	0.27
32_C	35_D	0.508	0.27
21_F	29_I	0.504	0.26
2_R	46_E	0.503	0.26
82_R	87_F	0.502	0.26
56_I	93_S	0.500	0.26

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2msxA	1	0.6311	29.2	0.926	Contact Map
2k6xA	1	0.4369	4.4	0.95	Contact Map
2ezvA	3	0.6214	3.1	0.953	Contact Map
2mgxA	1	0.5437	2.4	0.956	Contact Map
3qx3A	2	0.6408	2.3	0.956	Contact Map
3k9fC	1	0.8641	2.2	0.957	Contact Map
3fakA	1	0.6505	2.1	0.957	Contact Map
4gfhA	2	0.8447	1.9	0.958	Contact Map
3m4iA	2	0.7864	1.9	0.958	Contact Map
4khaA	1	0.3301	1.8	0.959	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.005 seconds.