DUF4363 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF4363 - Domain of unknown function (DUF4363)

PFAM:	PF14276	Sequences: IAIILLALLIGLSIFSQNYLNKSTDELSELLEEIEEAIENEDWEEAEEELEELEEKWEKKKKYLSIFIDHDEIDEIETSLARLKAYIEAEDKDEALAELAELKELLEHIPEKEKLSLENI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	120 (119)
Sequences:	2197 (1985)
Seq/√Len:	182.0
META:	0.832

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
42_D	45_E	3.637	1.00
82_R	98_E	3.576	1.00
86_Y	97_A	3.159	1.00
43_W	90_E	2.936	1.00
53_L	80_L	2.737	1.00
54_E	84_K	2.724	1.00
91_D	94_E	2.689	1.00
38_I	95_A	2.375	1.00
34_I	53_L	2.368	1.00
79_S	98_E	2.336	1.00
72_E	108_H	2.253	1.00
82_R	101_E	2.198	1.00
10_I	14_I	2.109	1.00
61_K	77_E	2.100	1.00
32_E	103_K	2.031	1.00
33_E	49_E	1.953	1.00
37_A	49_E	1.890	1.00
76_I	102_L	1.889	1.00
94_E	97_A	1.862	1.00
87_I	95_A	1.837	1.00
43_W	46_A	1.829	1.00
41_E	92_K	1.806	1.00
49_E	52_E	1.689	1.00
78_T	101_E	1.677	1.00
35_E	103_K	1.655	1.00
51_E	84_K	1.632	1.00
75_E	78_T	1.622	1.00
30_L	56_K	1.484	1.00
37_A	42_D	1.462	1.00
11_G	15_F	1.426	1.00
35_E	100_A	1.423	1.00
12_L	16_S	1.405	1.00
84_K	88_E	1.370	1.00
14_I	18_N	1.350	1.00
15_F	19_Y	1.325	1.00
45_E	49_E	1.289	1.00
47_E	88_E	1.274	1.00
47_E	51_E	1.272	1.00
17_Q	115_L	1.251	1.00
37_A	45_E	1.242	1.00
31_L	102_L	1.153	1.00
26_E	56_K	1.150	1.00
28_S	32_E	1.106	1.00
16_S	67_F	1.103	1.00
9_L	13_S	1.078	1.00
57_W	77_E	1.045	1.00
83_L	99_L	1.016	0.99
27_L	76_I	1.006	0.99
47_E	90_E	0.999	0.99
35_E	99_L	0.981	0.99
34_I	49_E	0.978	0.99
111_E	118_E	0.973	0.99
23_S	60_K	0.971	0.99
30_L	49_E	0.958	0.99
30_L	52_E	0.954	0.99
60_K	64_L	0.950	0.99
100_A	103_K	0.943	0.99
17_Q	20_L	0.943	0.99
44_E	47_E	0.943	0.99
16_S	63_Y	0.935	0.99
73_I	77_E	0.932	0.99
30_L	33_E	0.923	0.99
61_K	118_E	0.922	0.99
107_E	111_E	0.922	0.99
76_I	106_L	0.921	0.99
21_N	25_D	0.913	0.99
62_K	118_E	0.907	0.99
15_F	18_N	0.900	0.99
57_W	80_L	0.895	0.99
29_E	32_E	0.894	0.99
79_S	101_E	0.887	0.99
70_H	74_D	0.879	0.98
83_L	95_A	0.878	0.98
36_E	39_E	0.872	0.98
98_E	101_E	0.835	0.98
31_L	53_L	0.825	0.98
86_Y	91_D	0.822	0.98
64_L	67_F	0.813	0.97
26_E	30_L	0.806	0.97
16_S	113_E	0.798	0.97
86_Y	98_E	0.798	0.97
27_L	106_L	0.792	0.97
10_I	13_S	0.782	0.97
18_N	22_K	0.782	0.97
74_D	108_H	0.781	0.97
35_E	96_L	0.777	0.97
46_A	87_I	0.774	0.97
36_E	40_N	0.774	0.97
85_A	89_A	0.766	0.96
48_E	52_E	0.765	0.96
64_L	70_H	0.759	0.96
39_E	96_L	0.757	0.96
76_I	105_L	0.748	0.96
13_S	16_S	0.747	0.96
23_S	64_L	0.734	0.95
28_S	103_K	0.729	0.95
21_N	114_K	0.727	0.95
21_N	110_P	0.726	0.95
64_L	68_I	0.718	0.95
86_Y	93_D	0.714	0.95
80_L	102_L	0.712	0.95
54_E	58_E	0.711	0.95
45_E	48_E	0.711	0.95
85_A	100_A	0.710	0.95
5_L	13_S	0.707	0.94
50_L	87_I	0.704	0.94
81_A	104_E	0.703	0.94
52_E	55_E	0.701	0.94
33_E	36_E	0.697	0.94
6_L	10_I	0.696	0.94
35_E	39_E	0.695	0.94
50_L	77_E	0.690	0.94
14_I	17_Q	0.687	0.94
20_L	68_I	0.683	0.93
66_I	74_D	0.666	0.92
72_E	112_K	0.662	0.92
57_W	76_I	0.659	0.92
41_E	44_E	0.657	0.92
19_Y	63_Y	0.657	0.92
34_I	95_A	0.654	0.92
20_L	74_D	0.650	0.92
50_L	102_L	0.649	0.91
66_I	70_H	0.644	0.91
24_T	106_L	0.639	0.91
40_N	44_E	0.634	0.90
19_Y	67_F	0.633	0.90
95_A	99_L	0.631	0.90
13_S	17_Q	0.631	0.90
20_L	110_P	0.624	0.90
50_L	84_K	0.621	0.90
89_A	93_D	0.620	0.89
60_K	63_Y	0.617	0.89
4_I	7_A	0.615	0.89
75_E	105_L	0.613	0.89
38_I	43_W	0.612	0.89
86_Y	95_A	0.612	0.89
92_K	96_L	0.611	0.89
37_A	46_A	0.605	0.88
99_L	103_K	0.605	0.88
89_A	96_L	0.603	0.88
19_Y	23_S	0.595	0.88
98_E	105_L	0.593	0.87
82_R	86_Y	0.579	0.86
78_T	105_L	0.576	0.86
32_E	35_E	0.573	0.86
34_I	38_I	0.572	0.85
31_L	77_E	0.571	0.85
111_E	114_K	0.571	0.85
48_E	51_E	0.568	0.85
53_L	76_I	0.568	0.85
40_N	52_E	0.565	0.85
13_S	64_L	0.564	0.85
79_S	102_L	0.561	0.84
15_F	22_K	0.559	0.84
79_S	83_L	0.555	0.84
84_K	100_A	0.553	0.83
61_K	73_I	0.550	0.83
7_A	11_G	0.548	0.83
82_R	97_A	0.543	0.82
38_I	99_L	0.542	0.82
29_E	55_E	0.539	0.82
47_E	84_K	0.539	0.82
69_D	112_K	0.538	0.82
61_K	65_S	0.537	0.82
69_D	75_E	0.535	0.81
12_L	15_F	0.534	0.81
110_P	114_K	0.530	0.81
29_E	33_E	0.529	0.81
53_L	103_K	0.529	0.81
31_L	103_K	0.528	0.81
24_T	110_P	0.527	0.80
30_L	53_L	0.524	0.80
4_I	11_G	0.523	0.80
86_Y	94_E	0.514	0.79
65_S	108_H	0.509	0.78
16_S	19_Y	0.509	0.78
29_E	36_E	0.503	0.77
16_S	20_L	0.500	0.77

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3u8pA	1	0.9833	59.6	0.819	Contact Map
4jkvA	2	0.85	35.4	0.844	Contact Map
2kc7A	1	0.775	29.8	0.849	Contact Map
4qinA	2	1	20.8	0.86	Contact Map
3n71A	1	0.9417	19.4	0.863	Contact Map
2f95B	2	0.1333	17.7	0.865	Contact Map
2f93B	2	0.1333	14.9	0.869	Contact Map
3rfyA	2	1	12.7	0.873	Contact Map
4wuyA	1	0.9417	11.8	0.875	Contact Map
4cq4A	4	0.675	11.6	0.875	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.