DUF4326 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF4326 - Domain of unknown function (DUF4326)

PFAM:	PF14216	Sequences: KRTKGWRKPPNDVYVGRPSKWGNPFRIGKDVGTREEVIAKYREWLLGRLERDPELLAALAELRGKDLGCWCAPKPCHGDVLLE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	83 (76)
Sequences:	10312 (8465)
Seq/√Len:	971.0
META:	0.946

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
15_V	78_G	3.859	1.00
16_G	70_W	2.155	1.00
72_A	79_D	2.152	1.00
20_K	58_A	2.070	1.00
33_T	36_E	1.912	1.00
12_D	68_G	1.867	1.00
27_I	37_V	1.855	1.00
36_E	40_K	1.783	1.00
41_Y	80_V	1.774	1.00
18_P	22_G	1.716	1.00
35_E	75_P	1.710	1.00
58_A	61_E	1.660	1.00
12_D	66_D	1.640	1.00
13_V	65_K	1.629	1.00
42_R	46_L	1.594	1.00
44_W	48_R	1.593	1.00
34_R	38_I	1.478	1.00
14_Y	18_P	1.430	1.00
25_F	44_W	1.430	1.00
16_G	19_S	1.388	1.00
38_I	80_V	1.381	1.00
66_D	82_L	1.322	1.00
28_G	33_T	1.257	1.00
75_P	79_D	1.220	1.00
48_R	52_D	1.218	1.00
9_P	12_D	1.211	1.00
34_R	74_K	1.208	1.00
24_P	44_W	1.205	1.00
8_K	68_G	1.195	1.00
14_Y	70_W	1.166	1.00
54_E	58_A	1.154	1.00
27_I	34_R	1.150	1.00
51_R	54_E	1.141	1.00
38_I	75_P	1.095	1.00
25_F	40_K	1.084	1.00
27_I	33_T	1.055	1.00
11_N	66_D	1.046	1.00
32_G	36_E	1.038	1.00
26_R	30_D	1.035	1.00
52_D	55_L	1.024	1.00
6_W	9_P	1.018	1.00
17_R	22_G	1.014	1.00
56_L	60_A	1.006	1.00
8_K	14_Y	0.995	1.00
56_L	59_L	0.985	1.00
5_G	8_K	0.984	1.00
59_L	62_L	0.967	1.00
20_K	61_E	0.965	1.00
52_D	56_L	0.946	1.00
42_R	80_V	0.939	1.00
55_L	58_A	0.937	1.00
14_Y	19_S	0.927	1.00
32_G	40_K	0.921	1.00
11_N	68_G	0.920	1.00
32_G	37_V	0.912	1.00
53_P	57_A	0.878	1.00
41_Y	81_L	0.869	1.00
36_E	39_A	0.858	1.00
48_R	51_R	0.851	1.00
35_E	39_A	0.847	1.00
8_K	11_N	0.825	1.00
28_G	32_G	0.817	1.00
48_R	53_P	0.814	1.00
67_L	78_G	0.806	1.00
26_R	29_K	0.798	1.00
43_E	46_L	0.796	1.00
5_G	9_P	0.794	1.00
55_L	59_L	0.768	1.00
30_D	33_T	0.765	1.00
19_S	22_G	0.760	1.00
39_A	75_P	0.760	1.00
26_R	32_G	0.756	1.00
48_R	55_L	0.753	1.00
57_A	60_A	0.746	1.00
60_A	63_R	0.739	1.00
62_L	65_K	0.728	1.00
48_R	54_E	0.720	1.00
73_P	79_D	0.700	1.00
21_W	81_L	0.688	1.00
52_D	58_A	0.683	1.00
39_A	43_E	0.672	1.00
30_D	40_K	0.670	1.00
6_W	12_D	0.669	1.00
5_G	11_N	0.664	1.00
54_E	57_A	0.663	1.00
8_K	12_D	0.656	1.00
69_C	76_C	0.641	1.00
45_L	80_V	0.632	1.00
79_D	82_L	0.630	1.00
6_W	11_N	0.624	1.00
27_I	30_D	0.619	1.00
47_G	51_R	0.613	1.00
53_P	56_L	0.612	1.00
34_R	37_V	0.608	1.00
13_V	21_W	0.606	1.00
45_L	58_A	0.604	1.00
43_E	47_G	0.604	1.00
40_K	43_E	0.600	1.00
27_I	32_G	0.591	1.00
72_A	75_P	0.573	1.00
71_C	76_C	0.573	1.00
5_G	12_D	0.564	1.00
41_Y	45_L	0.562	1.00
38_I	42_R	0.559	1.00
44_W	47_G	0.556	1.00
18_P	70_W	0.556	1.00
50_E	54_E	0.556	1.00
6_W	10_P	0.549	1.00
21_W	58_A	0.546	1.00
29_K	32_G	0.522	1.00
54_E	59_L	0.520	1.00
45_L	81_L	0.515	1.00
33_T	37_V	0.514	1.00
6_W	70_W	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3qmlC	1	0.253	5	0.905	Contact Map
4bpeL	1	0.9398	4.1	0.909	Contact Map
2kncB	1	0.3494	3.2	0.914	Contact Map
3iogA	1	0.4819	3.2	0.914	Contact Map
4lhdA	2	0.8675	3.1	0.914	Contact Map
1s4xA	1	0.3494	2.9	0.915	Contact Map
2kv9B	1	0.3494	2.8	0.917	Contact Map
4owtC	1	0.3855	2.7	0.917	Contact Map
4um9B	2	0	2.5	0.919	Contact Map
1ffyA	1	0.988	2.4	0.919	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0046 seconds.