DUF4314 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF4314 - Domain of unknown function (DUF4314)

PFAM:	PF14192	Sequences: TEAERGLMHYYDEDEDDGVNEKVYGFRVDTEKYAYLLRCNSGIRFVEYREGFLWGVAECIVIGELTGEELELLKEYIFGQASDGWGEGFEQREIKVDDGELYVSFW	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	106 (87)
Sequences:	696 (441)
Seq/√Len:	47.3
META:	0.882

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
8_M	11_Y	3.272	1.00
42_G	57_A	3.124	1.00
10_Y	42_G	2.315	1.00
93_E	102_Y	2.286	1.00
57_A	81_A	2.097	1.00
45_F	58_E	2.013	0.99
77_I	81_A	1.974	0.99
7_L	10_Y	1.923	0.99
65_L	69_E	1.907	0.99
96_V	100_E	1.825	0.99
88_G	92_R	1.778	0.99
8_M	19_V	1.680	0.98
14_D	17_D	1.659	0.98
84_G	87_E	1.632	0.98
93_E	100_E	1.559	0.97
90_E	94_I	1.540	0.97
44_R	81_A	1.494	0.96
11_Y	19_V	1.479	0.96
42_G	76_Y	1.451	0.95
5_R	20_N	1.412	0.94
70_L	74_K	1.370	0.93
17_D	23_V	1.366	0.93
24_Y	60_I	1.339	0.93
6_G	56_V	1.322	0.92
15_E	18_G	1.318	0.92
48_Y	52_F	1.301	0.91
89_F	92_R	1.281	0.91
78_F	82_S	1.269	0.90
82_S	87_E	1.253	0.90
90_E	93_E	1.192	0.87
11_Y	17_D	1.168	0.86
44_R	57_A	1.163	0.86
84_G	88_G	1.155	0.86
42_G	77_I	1.155	0.86
49_R	54_W	1.137	0.85
100_E	104_S	1.120	0.84
16_D	19_V	1.096	0.82
75_E	78_F	1.094	0.82
83_D	91_Q	1.092	0.82
22_K	69_E	1.082	0.82
46_V	104_S	1.082	0.82
85_W	89_F	1.079	0.81
43_I	60_I	1.075	0.81
65_L	84_G	1.033	0.79
99_G	103_V	1.027	0.78
58_E	94_I	1.026	0.78
69_E	87_E	1.020	0.78
18_G	22_K	1.016	0.77
45_F	57_A	1.014	0.77
19_V	23_V	1.013	0.77
45_F	60_I	1.012	0.77
87_E	90_E	0.985	0.75
64_E	70_L	0.977	0.75
96_V	99_G	0.974	0.74
9_H	42_G	0.965	0.74
59_C	73_L	0.958	0.73
51_G	55_G	0.930	0.71
7_L	42_G	0.927	0.71
79_G	91_Q	0.913	0.69
48_Y	54_W	0.913	0.69
5_R	56_V	0.895	0.68
21_E	78_F	0.890	0.67
79_G	82_S	0.886	0.67
71_E	74_K	0.879	0.66
24_Y	78_F	0.863	0.65
8_M	23_V	0.862	0.65
47_E	51_G	0.835	0.62
83_D	87_E	0.822	0.61
95_K	100_E	0.807	0.60
45_F	48_Y	0.805	0.60
14_D	19_V	0.805	0.60
44_R	105_F	0.803	0.59
8_M	22_K	0.801	0.59
96_V	101_L	0.798	0.59
8_M	42_G	0.784	0.58
20_N	23_V	0.761	0.55
50_E	72_L	0.756	0.55
41_S	73_L	0.746	0.54
93_E	104_S	0.738	0.53
44_R	58_E	0.738	0.53
14_D	21_E	0.735	0.53
15_E	19_V	0.735	0.53
14_D	20_N	0.734	0.53
6_G	10_Y	0.730	0.52
58_E	100_E	0.727	0.52
54_W	105_F	0.727	0.52
61_V	71_E	0.722	0.51
59_C	81_A	0.721	0.51
44_R	85_W	0.720	0.51
65_L	70_L	0.697	0.49
12_D	52_F	0.695	0.49
69_E	84_G	0.684	0.48
24_Y	44_R	0.683	0.48
18_G	23_V	0.679	0.47
95_K	106_W	0.676	0.47
66_T	97_D	0.672	0.46
16_D	98_D	0.664	0.46
64_E	69_E	0.648	0.44
55_G	58_E	0.646	0.44
19_V	22_K	0.635	0.43
80_Q	84_G	0.635	0.43
58_E	61_V	0.631	0.42
8_M	61_V	0.628	0.42
82_S	94_I	0.626	0.42
46_V	76_Y	0.622	0.42
69_E	89_F	0.615	0.41
57_A	77_I	0.610	0.40
58_E	92_R	0.606	0.40
48_Y	76_Y	0.605	0.40
67_G	101_L	0.598	0.39
15_E	21_E	0.597	0.39
76_Y	81_A	0.585	0.38
56_V	74_K	0.583	0.38
50_E	54_W	0.577	0.37
48_Y	95_K	0.575	0.37
85_W	88_G	0.570	0.37
67_G	99_G	0.564	0.36
66_T	69_E	0.564	0.36
11_Y	72_L	0.562	0.36
81_A	85_W	0.562	0.36
52_F	60_I	0.559	0.36
17_D	20_N	0.543	0.34
48_Y	58_E	0.537	0.34
84_G	90_E	0.534	0.33
46_V	101_L	0.527	0.33
7_L	55_G	0.519	0.32
61_V	101_L	0.516	0.32
45_F	105_F	0.508	0.31
61_V	89_F	0.504	0.31
6_G	9_H	0.500	0.30

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3j8eG	3	0.4811	3.6	0.933	Contact Map
4c5eE	2	0.2358	3.2	0.935	Contact Map
1sa3A	1	0.4811	2.1	0.941	Contact Map
2l7kA	1	0.6792	2.1	0.941	Contact Map
4c5hB	1	0.1981	2	0.941	Contact Map
4c5iC	1	0.1226	1.8	0.943	Contact Map
4xypA	3	0.5283	1.8	0.943	Contact Map
4epuA	2	0.5	1.7	0.944	Contact Map
4mgqA	1	0.4906	1.6	0.945	Contact Map
3shgA	1	0.8302	1.6	0.945	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.