YjzC - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YjzC - YjzC-like protein

PFAM:	PF14168	Sequences: MGENTRFKPGEKAPNSGEYIEVGPRGGPVNNPREVTLEKGDRFPPTSNKGRKWKK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	55 (54)
Sequences:	890 (572)
Seq/√Len:	77.8
META:	0.726

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
9_P	46_T	2.974	1.00
38_E	41_D	2.717	1.00
18_E	34_E	2.287	1.00
6_R	52_K	2.209	1.00
24_P	27_G	2.204	1.00
18_E	36_T	2.182	1.00
7_F	14_P	2.087	1.00
12_K	42_R	2.086	1.00
8_K	52_K	1.723	1.00
48_N	51_R	1.631	1.00
7_F	43_F	1.574	0.99
37_L	43_F	1.550	0.99
29_V	32_P	1.437	0.99
37_L	41_D	1.435	0.99
7_F	11_E	1.382	0.99
22_V	54_K	1.372	0.99
8_K	11_E	1.338	0.98
33_R	47_S	1.331	0.98
13_A	17_G	1.315	0.98
47_S	51_R	1.302	0.98
3_E	28_P	1.224	0.97
20_I	28_P	1.197	0.97
16_S	38_E	1.152	0.96
22_V	52_K	1.050	0.93
23_G	27_G	1.015	0.92
5_T	55_K	0.989	0.91
16_S	41_D	0.976	0.90
6_R	24_P	0.973	0.90
20_I	29_V	0.950	0.89
13_A	43_F	0.944	0.89
13_A	40_G	0.940	0.88
8_K	45_P	0.935	0.88
9_P	52_K	0.932	0.88
21_E	47_S	0.913	0.87
21_E	29_V	0.900	0.86
14_P	40_G	0.881	0.85
46_T	50_G	0.874	0.84
23_G	26_G	0.850	0.83
42_R	45_P	0.821	0.81
8_K	50_G	0.796	0.78
19_Y	36_T	0.788	0.78
32_P	49_K	0.784	0.77
19_Y	53_W	0.776	0.77
2_G	34_E	0.771	0.76
21_E	37_L	0.761	0.75
19_Y	43_F	0.758	0.75
11_E	45_P	0.745	0.74
17_G	34_E	0.739	0.73
35_V	43_F	0.725	0.72
14_P	54_K	0.725	0.72
7_F	15_N	0.720	0.71
17_G	22_V	0.676	0.66
2_G	5_T	0.663	0.65
20_I	34_E	0.659	0.64
21_E	51_R	0.656	0.64
5_T	20_I	0.644	0.63
14_P	31_N	0.638	0.62
9_P	55_K	0.633	0.61
5_T	54_K	0.624	0.60
39_K	42_R	0.610	0.58
21_E	46_T	0.610	0.58
3_E	6_R	0.607	0.58
21_E	32_P	0.586	0.55
31_N	49_K	0.584	0.55
11_E	54_K	0.581	0.55
1_M	40_G	0.566	0.53
7_F	38_E	0.562	0.52
6_R	22_V	0.561	0.52
16_S	36_T	0.552	0.51
13_A	36_T	0.544	0.50
40_G	48_N	0.540	0.50
33_R	37_L	0.537	0.49
31_N	39_K	0.530	0.48
37_L	42_R	0.527	0.48
25_R	30_N	0.522	0.47
11_E	14_P	0.521	0.47
9_P	51_R	0.512	0.46
13_A	38_E	0.510	0.46
23_G	33_R	0.507	0.45
13_A	16_S	0.504	0.45
9_P	50_G	0.500	0.45

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3wnoA	2	1	4.1	0.883	Contact Map
1mscA	2	0.3091	3.7	0.885	Contact Map
2vtuJ	14	0.3091	3.6	0.885	Contact Map
2pn5A	1	1	3.3	0.888	Contact Map
2x41A	1	0.7636	3.2	0.889	Contact Map
4acqA	4	0.9636	3	0.89	Contact Map
1unaA	2	0.3273	2.6	0.894	Contact Map
4fxkA	1	0.9636	2.4	0.896	Contact Map
4bbjA	1	0.8727	2.3	0.897	Contact Map
3cu7A	2	0.9636	2.2	0.897	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0044 seconds.