SieB - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SieB - Superinfection exclusion protein B

PFAM:	PF14163	Sequences: ILLALAIASGLLLFLPDSLLEKLGLDEFREEYRPWIGLVFLLSLSLLLVNLLSWIFKWIKRKIRKKKLKKKIKKRLKSLTPEEKAILREFIIQNTRTLTLPIDDGVVAGLVAKGIIYRASNVYGLGGGAGLGFPYNIQPWAWEYLNKHPEL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	151 (145)
Sequences:	778 (713)
Seq/√Len:	59.2
META:	0.76

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
10_G	40_F	4.992	1.00
11_L	15_L	4.592	1.00
24_G	33_R	4.021	1.00
100_L	107_V	3.442	1.00
86_I	100_L	3.017	1.00
137_I	141_A	2.786	1.00
8_A	41_L	2.650	1.00
144_Y	148_H	2.450	1.00
137_I	142_W	2.343	1.00
75_R	113_K	2.257	1.00
6_A	44_L	2.136	1.00
94_N	146_N	2.107	1.00
6_A	10_G	2.082	1.00
127_G	132_G	2.073	1.00
106_V	109_G	1.988	1.00
69_K	73_K	1.963	1.00
23_L	37_G	1.882	1.00
72_I	140_W	1.873	1.00
111_V	118_R	1.846	1.00
21_E	26_D	1.709	0.99
100_L	116_I	1.688	0.99
133_F	137_I	1.672	0.99
109_G	113_K	1.667	0.99
96_R	142_W	1.638	0.99
87_L	91_I	1.636	0.99
9_S	40_F	1.559	0.98
34_P	38_L	1.553	0.98
86_I	106_V	1.480	0.98
140_W	144_Y	1.443	0.97
33_R	37_G	1.416	0.97
87_L	90_F	1.401	0.97
118_R	122_V	1.394	0.97
117_Y	136_N	1.393	0.97
141_A	145_L	1.377	0.97
51_L	54_W	1.365	0.96
90_F	98_L	1.357	0.96
89_E	93_Q	1.355	0.96
14_F	40_F	1.352	0.96
27_E	30_E	1.325	0.96
83_E	109_G	1.321	0.96
119_A	122_V	1.317	0.96
142_W	146_N	1.310	0.95
12_L	29_R	1.306	0.95
83_E	113_K	1.288	0.95
138_Q	141_A	1.279	0.95
5_L	39_V	1.269	0.95
15_L	19_L	1.268	0.95
116_I	145_L	1.258	0.94
108_A	112_A	1.234	0.94
20_L	29_R	1.190	0.92
105_G	136_N	1.185	0.92
20_L	25_L	1.185	0.92
135_Y	141_A	1.158	0.91
128_G	131_L	1.153	0.91
89_E	98_L	1.151	0.91
10_G	14_F	1.144	0.91
75_R	96_R	1.133	0.90
105_G	120_S	1.128	0.90
134_P	142_W	1.123	0.90
55_I	70_K	1.116	0.90
96_R	113_K	1.100	0.89
63_I	70_K	1.081	0.88
25_L	37_G	1.076	0.88
51_L	55_I	1.072	0.88
66_K	70_K	1.058	0.87
79_L	87_L	1.057	0.87
4_A	49_V	1.046	0.87
133_F	141_A	1.042	0.86
9_S	43_S	1.041	0.86
137_I	145_L	1.039	0.86
103_D	109_G	1.034	0.86
90_F	107_V	1.033	0.86
129_A	132_G	1.013	0.85
80_T	105_G	1.003	0.84
86_I	107_V	0.994	0.84
115_I	141_A	0.979	0.83
91_I	94_N	0.967	0.82
17_D	29_R	0.959	0.81
27_E	31_E	0.959	0.81
97_T	119_A	0.957	0.81
97_T	105_G	0.949	0.81
8_A	45_S	0.942	0.80
135_Y	138_Q	0.930	0.79
4_A	8_A	0.925	0.79
108_A	111_V	0.921	0.79
127_G	134_P	0.912	0.78
12_L	88_R	0.906	0.78
133_F	138_Q	0.905	0.77
88_R	92_I	0.896	0.77
105_G	117_Y	0.889	0.76
26_D	30_E	0.887	0.76
63_I	67_K	0.885	0.76
102_I	120_S	0.867	0.74
111_V	135_Y	0.865	0.74
106_V	116_I	0.857	0.74
4_A	46_L	0.847	0.73
80_T	96_R	0.847	0.73
83_E	96_R	0.833	0.71
85_A	101_P	0.827	0.71
22_K	49_V	0.827	0.71
98_L	107_V	0.825	0.71
83_E	134_P	0.815	0.70
139_P	145_L	0.811	0.69
11_L	16_P	0.799	0.68
14_F	37_G	0.796	0.68
109_G	136_N	0.793	0.68
83_E	106_V	0.791	0.67
20_L	26_D	0.782	0.67
28_F	32_Y	0.777	0.66
60_K	73_K	0.775	0.66
88_R	104_D	0.773	0.66
37_G	41_L	0.771	0.65
139_P	142_W	0.767	0.65
97_T	109_G	0.764	0.65
76_L	140_W	0.757	0.64
13_L	36_I	0.753	0.64
134_P	137_I	0.752	0.64
24_G	119_A	0.751	0.63
135_Y	140_W	0.748	0.63
74_K	112_A	0.748	0.63
143_E	147_K	0.742	0.62
96_R	109_G	0.740	0.62
92_I	101_P	0.737	0.62
8_A	14_F	0.731	0.61
109_G	117_Y	0.730	0.61
42_L	68_L	0.723	0.60
51_L	63_I	0.718	0.60
29_R	36_I	0.716	0.60
136_N	145_L	0.711	0.59
89_E	101_P	0.710	0.59
45_S	48_L	0.707	0.59
5_L	16_P	0.705	0.59
60_K	64_R	0.705	0.59
100_L	113_K	0.703	0.58
86_I	116_I	0.696	0.58
29_R	33_R	0.690	0.57
86_I	103_D	0.687	0.57
13_L	32_Y	0.686	0.56
135_Y	139_P	0.673	0.55
133_F	136_N	0.669	0.55
143_E	146_N	0.669	0.55
8_A	28_F	0.657	0.53
90_F	101_P	0.656	0.53
35_W	96_R	0.649	0.52
27_E	44_L	0.645	0.52
40_F	80_T	0.638	0.51
65_K	68_L	0.634	0.51
32_Y	36_I	0.632	0.50
65_K	114_G	0.626	0.50
130_G	141_A	0.624	0.50
27_E	73_K	0.623	0.49
128_G	134_P	0.619	0.49
113_K	142_W	0.616	0.49
66_K	147_K	0.616	0.49
98_L	116_I	0.612	0.48
73_K	144_Y	0.612	0.48
95_T	142_W	0.611	0.48
42_L	48_L	0.610	0.48
90_F	115_I	0.609	0.48
10_G	57_K	0.607	0.48
3_L	17_D	0.600	0.47
20_L	78_S	0.600	0.47
11_L	74_K	0.598	0.47
11_L	22_K	0.598	0.47
88_R	107_V	0.593	0.46
14_F	86_I	0.591	0.46
17_D	39_V	0.588	0.46
77_K	144_Y	0.587	0.45
4_A	45_S	0.584	0.45
80_T	97_T	0.583	0.45
137_I	140_W	0.583	0.45
90_F	95_T	0.579	0.45
131_L	141_A	0.578	0.44
115_I	134_P	0.575	0.44
36_I	42_L	0.574	0.44
79_L	84_K	0.571	0.44
103_D	106_V	0.570	0.44
12_L	19_L	0.568	0.43
76_L	79_L	0.566	0.43
89_E	92_I	0.566	0.43
131_L	134_P	0.563	0.43
28_F	36_I	0.562	0.43
23_L	41_L	0.561	0.43
3_L	47_L	0.558	0.42
41_L	143_E	0.555	0.42
74_K	78_S	0.555	0.42
4_A	10_G	0.551	0.42
31_E	34_P	0.546	0.41
84_K	87_L	0.541	0.40
95_T	98_L	0.538	0.40
9_S	39_V	0.537	0.40
128_G	132_G	0.536	0.40
67_K	74_K	0.534	0.40
58_W	68_L	0.532	0.39
29_R	76_L	0.532	0.39
133_F	142_W	0.532	0.39
92_I	95_T	0.531	0.39
3_L	8_A	0.528	0.39
48_L	67_K	0.526	0.39
80_T	106_V	0.524	0.39
95_T	107_V	0.524	0.39
8_A	13_L	0.523	0.39
120_S	134_P	0.521	0.38
80_T	117_Y	0.519	0.38
15_L	32_Y	0.516	0.38
85_A	102_I	0.515	0.38
57_K	61_R	0.513	0.37
90_F	116_I	0.511	0.37
95_T	104_D	0.510	0.37
88_R	98_L	0.509	0.37
28_F	34_P	0.506	0.37
41_L	70_K	0.506	0.37
15_L	59_I	0.506	0.37
48_L	79_L	0.505	0.37
130_G	133_F	0.504	0.37
18_S	27_E	0.501	0.36
70_K	74_K	0.501	0.36
90_F	106_V	0.500	0.36

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4mnuA	2	0.6623	25.6	0.898	Contact Map
3bpvA	2	0.649	19.8	0.903	Contact Map
2a61A	2	0.6556	18.1	0.904	Contact Map
1i1gA	5	0.4768	17.9	0.905	Contact Map
2pn6A	5	0.4768	17.8	0.905	Contact Map
4asnA	2	0.4768	16.8	0.906	Contact Map
1lj9A	2	0.649	16.7	0.906	Contact Map
4l9nA	2	0.6556	16.3	0.907	Contact Map
4h33A	3	0.4305	16.1	0.907	Contact Map
2qq9A	2	0.4437	15.5	0.907	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.