DUF4294 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF4294 - Domain of unknown function (DUF4294)

PFAM:	PF14127	Sequences: DTIPVIELPEVYVYPKLKFKNKKERRRYTRLVRNVKKVYPYAKLAGERLNELNERLATLPSKKERKKYIKKVEKELKKEFEDELKKLTITQGKILIKLIDRETGNTSYELIKELRGGFSAFFWQTVARLFGSNLKEEYDPEGEKEDRLIERIVQR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	155 (152)
Sequences:	4867 (2912)
Seq/√Len:	236.2
META:	0.932

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
61_S	64_E	3.822	1.00
34_N	91_Q	3.577	1.00
112_K	117_G	3.060	1.00
139_D	142_G	2.797	1.00
138_Y	150_E	2.767	1.00
81_E	85_K	2.566	1.00
35_V	94_I	2.546	1.00
34_N	90_T	2.539	1.00
128_R	133_N	2.348	1.00
32_V	36_K	2.140	1.00
77_K	81_E	2.132	1.00
55_R	58_T	2.026	1.00
55_R	68_Y	2.023	1.00
89_I	132_S	1.963	1.00
21_N	24_E	1.944	1.00
22_K	25_R	1.851	1.00
25_R	29_T	1.838	1.00
96_I	132_S	1.803	1.00
48_R	51_E	1.761	1.00
53_N	57_A	1.759	1.00
59_L	68_Y	1.751	1.00
44_L	48_R	1.659	1.00
52_L	72_V	1.649	1.00
48_R	79_E	1.532	1.00
46_G	102_E	1.525	1.00
51_E	55_R	1.519	1.00
39_Y	43_K	1.509	1.00
94_I	149_I	1.497	1.00
118_F	122_F	1.490	1.00
35_V	152_I	1.488	1.00
127_A	132_S	1.476	1.00
43_K	46_G	1.470	1.00
62_K	65_R	1.458	1.00
83_E	87_L	1.440	1.00
97_K	146_D	1.436	1.00
71_K	75_E	1.436	1.00
125_T	129_L	1.418	1.00
59_L	64_E	1.413	1.00
23_K	27_R	1.408	1.00
31_L	94_I	1.395	1.00
115_R	119_S	1.388	1.00
30_R	34_N	1.383	1.00
121_F	125_T	1.382	1.00
31_L	149_I	1.364	1.00
56_L	59_L	1.326	1.00
100_D	137_E	1.322	1.00
33_R	91_Q	1.303	1.00
64_E	67_K	1.300	1.00
45_A	99_I	1.291	1.00
97_K	143_E	1.259	1.00
44_L	79_E	1.230	1.00
52_L	68_Y	1.226	1.00
52_L	69_I	1.224	1.00
46_G	50_N	1.214	1.00
111_I	134_L	1.213	1.00
74_K	78_K	1.196	1.00
54_E	58_T	1.189	1.00
69_I	115_R	1.183	1.00
17_L	151_R	1.175	1.00
122_F	126_V	1.170	1.00
54_E	57_A	1.165	1.00
63_K	67_K	1.155	1.00
48_R	52_L	1.155	1.00
88_T	91_Q	1.150	1.00
96_I	134_L	1.141	1.00
68_Y	72_V	1.134	1.00
62_K	66_K	1.127	1.00
93_K	132_S	1.122	1.00
105_N	109_E	1.110	1.00
22_K	26_R	1.110	1.00
99_I	107_S	1.099	1.00
29_T	32_V	1.099	1.00
89_I	131_G	1.097	1.00
82_D	85_K	1.084	1.00
119_S	123_W	1.082	1.00
52_L	55_R	1.071	1.00
35_V	149_I	1.058	1.00
60_P	64_E	1.040	1.00
19_F	24_E	1.039	1.00
23_K	26_R	1.025	1.00
125_T	128_R	1.012	1.00
44_L	47_E	1.005	1.00
72_V	75_E	1.003	1.00
124_Q	133_N	0.995	1.00
50_N	54_E	0.993	1.00
18_K	21_N	0.993	1.00
37_K	91_Q	0.975	1.00
28_Y	32_V	0.965	1.00
24_E	27_R	0.964	1.00
148_L	152_I	0.957	1.00
148_L	151_R	0.944	1.00
81_E	123_W	0.942	1.00
67_K	71_K	0.939	1.00
105_N	113_E	0.934	1.00
124_Q	128_R	0.916	1.00
34_N	88_T	0.903	1.00
100_D	107_S	0.902	1.00
19_F	25_R	0.901	1.00
70_K	115_R	0.895	0.99
56_L	69_I	0.893	0.99
27_R	31_L	0.892	0.99
56_L	114_L	0.887	0.99
111_I	114_L	0.886	0.99
55_R	71_K	0.883	0.99
41_Y	44_L	0.883	0.99
38_V	42_A	0.882	0.99
51_E	68_Y	0.876	0.99
48_R	72_V	0.874	0.99
77_K	80_F	0.873	0.99
59_L	62_K	0.873	0.99
117_G	121_F	0.868	0.99
84_L	87_L	0.864	0.99
75_E	79_E	0.857	0.99
7_E	10_E	0.840	0.99
49_L	103_T	0.837	0.99
20_K	24_E	0.836	0.99
55_R	59_L	0.822	0.99
79_E	83_E	0.815	0.99
133_N	136_E	0.809	0.99
116_G	119_S	0.808	0.99
38_V	94_I	0.801	0.99
43_K	102_E	0.794	0.99
73_E	77_K	0.772	0.99
43_K	47_E	0.769	0.98
30_R	33_R	0.769	0.98
93_K	136_E	0.765	0.98
12_Y	15_P	0.765	0.98
41_Y	80_F	0.763	0.98
34_N	94_I	0.754	0.98
53_N	105_N	0.748	0.98
49_L	53_N	0.747	0.98
19_F	28_Y	0.746	0.98
106_T	137_E	0.740	0.98
119_S	126_V	0.739	0.98
87_L	92_G	0.735	0.98
33_R	37_K	0.728	0.98
6_I	9_P	0.724	0.98
57_A	60_P	0.722	0.98
16_K	19_F	0.720	0.98
76_L	111_I	0.719	0.98
127_A	134_L	0.711	0.97
52_L	56_L	0.711	0.97
49_L	110_L	0.696	0.97
101_R	150_E	0.695	0.97
80_F	83_E	0.694	0.97
75_E	78_K	0.692	0.97
141_E	147_R	0.689	0.97
78_K	82_D	0.689	0.97
72_V	80_F	0.687	0.97
45_A	84_L	0.683	0.97
28_Y	148_L	0.683	0.97
56_L	65_R	0.678	0.97
147_R	151_R	0.677	0.97
93_K	96_I	0.674	0.97
50_N	53_N	0.671	0.96
44_L	80_F	0.667	0.96
41_Y	83_E	0.662	0.96
107_S	110_L	0.661	0.96
70_K	74_K	0.660	0.96
89_I	96_I	0.659	0.96
30_R	90_T	0.659	0.96
42_A	46_G	0.658	0.96
14_Y	19_F	0.652	0.96
89_I	127_A	0.649	0.96
19_F	22_K	0.647	0.96
27_R	30_R	0.644	0.95
38_V	87_L	0.638	0.95
17_L	21_N	0.626	0.95
108_Y	121_F	0.623	0.95
126_V	130_F	0.622	0.95
139_D	143_E	0.618	0.94
7_E	14_Y	0.616	0.94
100_D	106_T	0.616	0.94
39_Y	94_I	0.615	0.94
38_V	88_T	0.613	0.94
49_L	114_L	0.608	0.94
123_W	132_S	0.604	0.94
53_N	110_L	0.598	0.93
14_Y	21_N	0.594	0.93
91_Q	94_I	0.587	0.93
44_L	83_E	0.586	0.93
73_E	124_Q	0.582	0.92
109_E	112_K	0.581	0.92
31_L	152_I	0.581	0.92
111_I	115_R	0.579	0.92
106_T	109_E	0.577	0.92
149_I	152_I	0.574	0.92
9_P	111_I	0.574	0.92
45_A	76_L	0.568	0.91
90_T	94_I	0.566	0.91
143_E	148_L	0.566	0.91
77_K	115_R	0.560	0.91
42_A	45_A	0.559	0.91
33_R	88_T	0.557	0.91
42_A	95_L	0.557	0.91
74_K	77_K	0.554	0.90
136_E	143_E	0.552	0.90
46_G	103_T	0.549	0.90
3_I	9_P	0.549	0.90
72_V	114_L	0.546	0.90
124_Q	134_L	0.543	0.90
123_W	126_V	0.540	0.89
96_I	107_S	0.539	0.89
69_I	73_E	0.539	0.89
53_N	113_E	0.538	0.89
9_P	12_Y	0.538	0.89
14_Y	154_Q	0.538	0.89
35_V	98_L	0.537	0.89
30_R	91_Q	0.536	0.89
34_N	38_V	0.535	0.89
34_N	37_K	0.535	0.89
124_Q	135_K	0.535	0.89
5_V	18_K	0.533	0.89
37_K	83_E	0.531	0.89
26_R	29_T	0.527	0.88
60_P	63_K	0.526	0.88
23_K	29_T	0.522	0.88
90_T	93_K	0.521	0.88
138_Y	143_E	0.518	0.87
53_N	114_L	0.516	0.87
77_K	123_W	0.515	0.87
6_I	14_Y	0.514	0.87
47_E	51_E	0.513	0.87
28_Y	152_I	0.511	0.87
73_E	130_F	0.509	0.86
92_G	95_L	0.504	0.86
114_L	117_G	0.502	0.86
77_K	111_I	0.500	0.85

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1pxyA	1	0.6	14.4	0.947	Contact Map
1h67A	1	0.6	13.1	0.948	Contact Map
4x86A	1	0.1935	12.2	0.949	Contact Map
1wynA	1	0.6903	10.8	0.95	Contact Map
1wypA	1	0.6903	9.4	0.952	Contact Map
4yv9A	3	0.4903	9.3	0.952	Contact Map
2wujA	2	0.2129	8.1	0.953	Contact Map
1sz9A	1	0.6387	7.6	0.953	Contact Map
2q5xA	1	0.5613	6.9	0.954	Contact Map
1dxxA	2	0.6129	6.8	0.955	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.