DUF4282 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF4282 - Domain of unknown function (DUF4282)

PFAM:	PF14110	Sequences: DFSFDRFITPKIIKVLYWLGLVLIVLGGLGGIFSGFGASSALSPLGGLLLLILGPLGFLLGLLFWRIYCELLIVLFRINENLRAIRQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	87 (83)
Sequences:	5890 (4361)
Seq/√Len:	478.7
META:	0.921

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
20_G	65_W	4.618	1.00
21_L	62_L	3.057	1.00
28_G	58_F	2.561	1.00
79_N	83_R	2.513	1.00
81_N	86_R	2.342	1.00
64_F	68_Y	2.315	1.00
25_V	58_F	2.213	1.00
78_I	82_L	2.186	1.00
13_I	69_C	2.144	1.00
24_I	65_W	2.006	1.00
71_L	75_L	1.915	1.00
75_L	78_I	1.893	1.00
81_N	84_A	1.708	1.00
3_S	14_K	1.629	1.00
77_R	80_E	1.537	1.00
28_G	54_G	1.536	1.00
68_Y	71_L	1.525	1.00
14_K	18_W	1.525	1.00
24_I	61_G	1.508	1.00
2_F	18_W	1.472	1.00
74_V	79_N	1.414	1.00
58_F	62_L	1.395	1.00
6_R	11_K	1.362	1.00
1_D	5_D	1.356	1.00
82_L	85_I	1.285	1.00
13_I	73_I	1.278	1.00
45_L	49_L	1.253	1.00
24_I	58_F	1.237	1.00
5_D	77_R	1.212	1.00
7_F	73_I	1.204	1.00
47_G	51_L	1.152	1.00
9_T	67_I	1.145	1.00
20_G	69_C	1.110	1.00
60_L	64_F	1.108	1.00
47_G	50_L	1.099	1.00
12_I	16_L	1.093	1.00
39_S	47_G	1.080	1.00
25_V	62_L	1.047	1.00
18_W	22_V	1.016	1.00
68_Y	72_L	1.000	1.00
83_R	86_R	0.996	1.00
78_I	81_N	0.972	1.00
65_W	69_C	0.922	1.00
82_L	86_R	0.916	1.00
49_L	53_L	0.908	1.00
30_G	34_S	0.907	1.00
33_F	36_F	0.898	1.00
31_G	57_G	0.895	1.00
27_G	61_G	0.879	1.00
77_R	83_R	0.868	1.00
29_L	33_F	0.850	1.00
46_G	50_L	0.846	1.00
22_V	26_L	0.839	1.00
79_N	82_L	0.834	1.00
48_L	51_L	0.822	1.00
39_S	50_L	0.820	1.00
32_I	54_G	0.813	1.00
9_T	12_I	0.811	1.00
31_G	34_S	0.808	1.00
3_S	6_R	0.801	1.00
52_I	55_P	0.792	1.00
44_P	48_L	0.788	1.00
59_L	62_L	0.787	1.00
44_P	47_G	0.786	1.00
32_I	35_G	0.783	1.00
36_F	39_S	0.768	1.00
35_G	47_G	0.754	1.00
65_W	68_Y	0.743	1.00
47_G	55_P	0.742	1.00
54_G	58_F	0.739	1.00
55_P	59_L	0.731	1.00
75_L	79_N	0.716	1.00
72_L	76_F	0.715	1.00
28_G	55_P	0.709	1.00
43_S	46_G	0.708	1.00
20_G	24_I	0.700	1.00
53_L	57_G	0.696	1.00
10_P	80_E	0.693	1.00
11_K	14_K	0.692	1.00
13_I	76_F	0.685	1.00
43_S	47_G	0.682	1.00
24_I	62_L	0.675	1.00
34_S	38_A	0.673	1.00
16_L	69_C	0.673	1.00
4_F	7_F	0.672	1.00
57_G	61_G	0.660	1.00
10_P	73_I	0.658	1.00
47_G	54_G	0.653	1.00
17_Y	62_L	0.652	1.00
32_I	36_F	0.644	1.00
64_F	72_L	0.643	1.00
16_L	67_I	0.638	1.00
12_I	67_I	0.630	1.00
61_G	65_W	0.627	1.00
36_F	47_G	0.621	0.99
55_P	58_F	0.620	0.99
63_L	67_I	0.620	0.99
26_L	29_L	0.616	0.99
51_L	55_P	0.590	0.99
3_S	18_W	0.587	0.99
34_S	37_G	0.582	0.99
17_Y	59_L	0.582	0.99
38_A	47_G	0.580	0.99
7_F	74_V	0.573	0.99
52_I	56_L	0.568	0.99
76_F	82_L	0.567	0.99
35_G	51_L	0.565	0.99
5_D	14_K	0.563	0.99
30_G	38_A	0.549	0.99
59_L	63_L	0.548	0.99
32_I	39_S	0.548	0.99
47_G	52_I	0.545	0.99
49_L	56_L	0.545	0.99
7_F	77_R	0.545	0.99
28_G	32_I	0.528	0.98
38_A	50_L	0.525	0.98
10_P	14_K	0.523	0.98
32_I	51_L	0.522	0.98
9_T	72_L	0.514	0.98
1_D	62_L	0.510	0.98
27_G	43_S	0.510	0.98
11_K	15_V	0.502	0.98
49_L	52_I	0.501	0.98
16_L	63_L	0.500	0.98

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2bs2C	2	0.977	1.8	0.894	Contact Map
2f93B	2	0.5172	1.3	0.901	Contact Map
4i5sA	2	0.2989	1.3	0.902	Contact Map
3wu2X	1	0.4368	1.3	0.902	Contact Map
3j5pB	3	1	1.1	0.905	Contact Map
2kluA	1	0.5517	1.1	0.905	Contact Map
5a63B	1	0.8966	1.1	0.906	Contact Map
4pbyC	1	0	1.1	0.906	Contact Map
3tx3A	2	0.9425	1.1	0.907	Contact Map
4ev6A	3	0.8276	1	0.908	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.