DUF4277 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF4277 - Domain of unknown function (DUF4277)

PFAM:	PF14104	Sequences: IQTERLGHLPLVAGFLDRLGLAEIIDRHLPPDPRRKLSPGQVVLALVLNILGFGRRPLYRVPEWAARKDLELLLGEGIEAEDLNDDRLGRALDALFDAGRTSLFTEIAL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	109 (103)
Sequences:	8956 (4873)
Seq/√Len:	480.2
META:	0.97

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
20_G	23_E	4.790	1.00
22_A	44_L	3.543	1.00
26_D	38_S	2.790	1.00
36_K	82_D	2.783	1.00
17_D	44_L	2.643	1.00
39_P	91_A	2.346	1.00
43_V	91_A	2.188	1.00
28_H	106_E	2.079	1.00
65_A	83_L	1.928	1.00
79_E	82_D	1.895	1.00
22_A	41_Q	1.869	1.00
16_L	44_L	1.842	1.00
61_V	88_L	1.842	1.00
38_S	41_Q	1.807	1.00
39_P	94_A	1.790	1.00
13_A	17_D	1.724	1.00
45_A	83_L	1.691	1.00
26_D	40_G	1.609	1.00
27_R	106_E	1.581	1.00
42_V	91_A	1.498	1.00
24_I	27_R	1.403	1.00
42_V	87_R	1.373	1.00
13_A	48_L	1.347	1.00
95_L	100_R	1.323	1.00
99_G	102_S	1.312	1.00
9_L	48_L	1.290	1.00
16_L	21_L	1.290	1.00
46_L	88_L	1.286	1.00
20_G	24_I	1.270	1.00
16_L	22_A	1.257	1.00
43_V	95_L	1.212	1.00
41_Q	74_L	1.208	1.00
45_A	74_L	1.169	1.00
26_D	41_Q	1.142	1.00
100_R	104_F	1.139	1.00
22_A	26_D	1.112	1.00
24_I	28_H	1.097	1.00
31_P	34_R	1.084	1.00
41_Q	76_E	1.079	1.00
84_N	90_R	1.074	1.00
25_I	43_V	1.073	1.00
31_P	35_R	1.067	1.00
101_T	105_T	1.063	1.00
60_R	63_E	1.063	1.00
66_A	80_A	1.061	1.00
62_P	80_A	1.058	1.00
35_R	94_A	1.055	1.00
8_H	53_F	1.034	1.00
42_V	88_L	1.025	1.00
35_R	39_P	1.025	1.00
98_A	103_L	1.024	1.00
24_I	106_E	0.991	1.00
44_L	48_L	0.980	1.00
29_L	39_P	0.975	1.00
14_G	17_D	0.968	1.00
54_G	61_V	0.966	1.00
22_A	40_G	0.961	1.00
23_E	27_R	0.955	1.00
49_N	64_W	0.947	1.00
36_K	87_R	0.944	1.00
85_D	89_G	0.938	1.00
16_L	47_V	0.937	1.00
41_Q	75_G	0.927	1.00
21_L	47_V	0.927	1.00
63_E	66_A	0.922	1.00
102_S	106_E	0.914	1.00
49_N	57_P	0.904	1.00
70_L	74_L	0.899	1.00
17_D	22_A	0.898	1.00
46_L	61_V	0.894	1.00
62_P	81_E	0.885	1.00
102_S	105_T	0.878	1.00
15_F	18_R	0.862	1.00
39_P	42_V	0.861	1.00
98_A	106_E	0.856	1.00
35_R	87_R	0.848	1.00
32_D	35_R	0.847	1.00
71_E	75_G	0.844	1.00
71_E	77_G	0.831	1.00
59_Y	85_D	0.810	1.00
45_A	65_A	0.809	1.00
70_L	75_G	0.806	1.00
28_H	103_L	0.794	1.00
86_D	90_R	0.790	1.00
39_P	87_R	0.785	1.00
8_H	12_V	0.781	1.00
62_P	84_N	0.778	1.00
34_R	90_R	0.777	1.00
25_I	29_L	0.776	1.00
96_F	100_R	0.759	1.00
90_R	93_D	0.758	1.00
72_L	75_G	0.755	1.00
61_V	64_W	0.752	1.00
16_L	19_L	0.732	1.00
37_L	45_A	0.732	1.00
101_T	104_F	0.729	1.00
31_P	38_S	0.728	1.00
75_G	78_I	0.726	1.00
69_D	72_L	0.723	1.00
24_I	107_I	0.709	1.00
58_L	93_D	0.707	1.00
46_L	49_N	0.690	1.00
10_P	50_I	0.687	1.00
70_L	80_A	0.687	1.00
29_L	98_A	0.686	1.00
9_L	13_A	0.682	1.00
13_A	44_L	0.682	1.00
49_N	53_F	0.681	1.00
45_A	61_V	0.673	1.00
16_L	48_L	0.667	1.00
21_L	107_I	0.667	1.00
89_G	93_D	0.665	1.00
14_G	18_R	0.661	1.00
10_P	14_G	0.658	1.00
11_L	15_F	0.652	1.00
50_I	55_R	0.643	1.00
54_G	60_R	0.642	1.00
4_E	69_D	0.640	1.00
12_V	51_L	0.623	0.99
24_I	103_L	0.621	0.99
54_G	57_P	0.613	0.99
57_P	60_R	0.608	0.99
100_R	105_T	0.608	0.99
81_E	84_N	0.607	0.99
37_L	42_V	0.605	0.99
37_L	82_D	0.602	0.99
49_N	54_G	0.595	0.99
31_P	94_A	0.589	0.99
29_L	94_A	0.586	0.99
65_A	88_L	0.583	0.99
85_D	90_R	0.582	0.99
25_I	103_L	0.569	0.99
6_L	68_K	0.566	0.99
22_A	38_S	0.563	0.99
96_F	105_T	0.559	0.99
70_L	77_G	0.556	0.99
46_L	92_L	0.555	0.99
74_L	83_L	0.552	0.99
93_D	96_F	0.550	0.99
55_R	61_V	0.549	0.99
71_E	74_L	0.536	0.98
32_D	39_P	0.532	0.98
46_L	91_A	0.531	0.98
24_I	30_P	0.530	0.98
64_W	68_K	0.528	0.98
6_L	10_P	0.526	0.98
5_R	68_K	0.524	0.98
103_L	107_I	0.520	0.98
30_P	98_A	0.519	0.98
87_R	91_A	0.511	0.98
57_P	89_G	0.508	0.98
58_L	89_G	0.504	0.98
35_R	69_D	0.502	0.98
44_L	74_L	0.500	0.98

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3rf7A	2	0.9174	5.8	0.92	Contact Map
1z67A	1	0.8807	4.7	0.924	Contact Map
3zokA	4	0.9541	3.4	0.928	Contact Map
2c4wA	2	0.6789	3.1	0.93	Contact Map
3m1tA	1	0.9174	2.8	0.932	Contact Map
2pftA	1	0.8532	2.6	0.932	Contact Map
3j16B	1	0.8349	2.5	0.933	Contact Map
3c19A	3	0.4312	2.3	0.935	Contact Map
3f3fC	2	0.3578	2.3	0.935	Contact Map
3dmqA	1	0.9817	2.3	0.935	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0054 seconds.