SSPI - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SSPI - Small, acid-soluble spore protein I

PFAM:	PF14098	Sequences: LNLRQAIIQNVKGNSEEELEETIEDAIQSGEEKTLPGLGVLFEVIWKNSDEEEKQEMLETLEQGL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	65 (65)
Sequences:	638 (438)
Seq/√Len:	54.3
META:	0.583

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
45_I	57_M	3.476	1.00
51_E	54_K	3.333	1.00
50_D	53_E	2.632	1.00
49_S	57_M	2.224	1.00
15_S	18_E	2.213	1.00
19_L	61_L	2.175	1.00
2_N	5_Q	2.106	1.00
1_L	5_Q	1.947	1.00
44_V	64_G	1.922	1.00
4_R	43_E	1.719	0.99
27_I	47_K	1.713	0.99
20_E	54_K	1.660	0.99
29_S	47_K	1.474	0.97
3_L	11_V	1.430	0.96
53_E	57_M	1.410	0.96
23_I	58_L	1.395	0.96
59_E	63_Q	1.335	0.95
53_E	56_E	1.323	0.94
10_N	31_E	1.253	0.93
11_V	22_T	1.252	0.93
55_Q	59_E	1.240	0.92
29_S	34_T	1.224	0.92
48_N	60_T	1.194	0.91
3_L	36_P	1.157	0.89
19_L	62_E	1.155	0.89
45_I	61_L	1.120	0.88
16_E	59_E	1.116	0.88
45_I	49_S	1.094	0.87
48_N	64_G	1.063	0.85
26_A	31_E	1.039	0.84
16_E	58_L	1.029	0.83
20_E	24_E	0.995	0.81
6_A	33_K	0.991	0.81
53_E	60_T	0.985	0.80
56_E	60_T	0.974	0.79
10_N	22_T	0.971	0.79
60_T	64_G	0.965	0.79
58_L	61_L	0.955	0.78
11_V	41_L	0.942	0.77
21_E	25_D	0.877	0.72
51_E	55_Q	0.872	0.71
2_N	30_G	0.872	0.71
22_T	26_A	0.865	0.71
14_N	18_E	0.860	0.70
59_E	62_E	0.849	0.69
55_Q	63_Q	0.841	0.69
44_V	48_N	0.825	0.67
14_N	45_I	0.825	0.67
58_L	62_E	0.807	0.65
42_F	45_I	0.806	0.65
25_D	32_E	0.798	0.65
7_I	11_V	0.792	0.64
14_N	22_T	0.783	0.63
3_L	34_T	0.777	0.62
6_A	11_V	0.771	0.62
16_E	62_E	0.771	0.62
26_A	33_K	0.741	0.59
3_L	6_A	0.740	0.59
3_L	41_L	0.736	0.58
7_I	46_W	0.721	0.57
15_S	50_D	0.696	0.54
27_I	43_E	0.696	0.54
19_L	57_M	0.681	0.53
32_E	38_L	0.671	0.51
19_L	58_L	0.671	0.51
1_L	9_Q	0.669	0.51
26_A	46_W	0.668	0.51
7_I	44_V	0.667	0.51
49_S	63_Q	0.665	0.51
52_E	56_E	0.660	0.50
20_E	44_V	0.660	0.50
48_N	63_Q	0.649	0.49
30_G	33_K	0.644	0.49
50_D	56_E	0.637	0.48
52_E	59_E	0.635	0.48
11_V	19_L	0.635	0.48
18_E	21_E	0.632	0.47
25_D	28_Q	0.621	0.46
9_Q	12_K	0.619	0.46
11_V	23_I	0.599	0.44
50_D	55_Q	0.599	0.44
7_I	10_N	0.598	0.44
34_T	47_K	0.580	0.42
2_N	43_E	0.563	0.40
27_I	58_L	0.560	0.40
7_I	41_L	0.558	0.40
42_F	61_L	0.550	0.39
2_N	34_T	0.550	0.39
8_I	44_V	0.550	0.39
53_E	59_E	0.549	0.39
6_A	38_L	0.547	0.38
24_E	50_D	0.524	0.36
13_G	58_L	0.523	0.36
21_E	28_Q	0.521	0.36
33_K	36_P	0.515	0.35
24_E	28_Q	0.505	0.34
13_G	28_Q	0.503	0.34
11_V	14_N	0.500	0.34

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3mydA	1	0.8308	26.3	0.874	Contact Map
2x24A	2	0	26	0.875	Contact Map
3a5iA	1	0.7538	22.1	0.878	Contact Map
4l2hA	1	0.9385	18.4	0.883	Contact Map
4wz8B	2	0.2462	13.9	0.889	Contact Map
3mixA	1	0.7385	13.9	0.889	Contact Map
4qjuA	2	0.9692	13.5	0.89	Contact Map
1a59A	2	0.8923	12.9	0.891	Contact Map
3my7A	2	0.6308	12.3	0.892	Contact Map
1cshA	2	0.8923	11.8	0.893	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.