DUF4274 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF4274 - Domain of unknown function (DUF4274)

PFAM:	PF14096	Sequences: ASPEELHLFALNYNWDDGFEVLRWIIENPNCDLGTALLIFWLADPDYYLQYADREEVPDYEREWFDLLKEIEERIL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	76 (74)
Sequences:	899 (759)
Seq/√Len:	88.2
META:	0.834

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
40_F	72_E	3.893	1.00
7_H	35_T	3.412	1.00
27_E	70_E	2.910	1.00
15_W	43_A	2.819	1.00
13_Y	18_G	2.558	1.00
6_L	28_N	2.311	1.00
33_L	75_I	2.301	1.00
10_A	39_I	2.281	1.00
38_L	42_L	2.172	1.00
31_C	36_A	2.042	1.00
54_R	66_D	2.033	1.00
6_L	24_W	1.998	1.00
24_W	28_N	1.951	1.00
26_I	39_I	1.749	1.00
23_R	70_E	1.622	1.00
6_L	31_C	1.542	1.00
11_L	38_L	1.521	1.00
13_Y	17_D	1.521	1.00
23_R	27_E	1.495	1.00
21_V	25_I	1.460	0.99
7_H	38_L	1.325	0.99
41_W	45_P	1.291	0.99
67_L	71_I	1.278	0.99
70_E	74_R	1.273	0.98
22_L	39_I	1.234	0.98
66_D	69_K	1.216	0.98
40_F	49_L	1.206	0.98
3_P	7_H	1.163	0.97
43_A	68_L	1.161	0.97
9_F	21_V	1.151	0.97
8_L	12_N	1.133	0.97
47_Y	50_Q	1.112	0.96
6_L	30_N	1.092	0.96
13_Y	21_V	1.072	0.96
8_L	11_L	1.027	0.94
25_I	31_C	0.963	0.92
41_W	72_E	0.962	0.92
19_F	67_L	0.941	0.91
56_E	59_D	0.891	0.89
55_E	58_P	0.889	0.89
2_S	5_E	0.863	0.87
44_D	47_Y	0.847	0.86
21_V	43_A	0.826	0.85
51_Y	58_P	0.826	0.85
48_Y	68_L	0.825	0.85
65_F	69_K	0.803	0.83
5_E	9_F	0.793	0.82
26_I	67_L	0.777	0.81
10_A	35_T	0.776	0.81
54_R	57_V	0.767	0.80
5_E	41_W	0.766	0.80
19_F	64_W	0.766	0.80
62_R	73_E	0.764	0.80
52_A	56_E	0.752	0.79
11_L	42_L	0.751	0.79
40_F	47_Y	0.730	0.77
20_E	55_E	0.723	0.76
25_I	28_N	0.720	0.76
17_D	21_V	0.720	0.76
43_A	67_L	0.711	0.75
9_F	25_I	0.708	0.75
14_N	18_G	0.697	0.74
2_S	8_L	0.692	0.73
64_W	68_L	0.680	0.72
21_V	24_W	0.679	0.72
51_Y	55_E	0.668	0.70
63_E	66_D	0.655	0.69
60_Y	63_E	0.654	0.69
32_D	35_T	0.653	0.69
55_E	59_D	0.646	0.68
48_Y	64_W	0.631	0.66
26_I	70_E	0.626	0.65
57_V	62_R	0.620	0.65
34_G	37_L	0.619	0.65
49_L	74_R	0.611	0.64
48_Y	61_E	0.601	0.62
55_E	60_Y	0.595	0.62
54_R	58_P	0.590	0.61
13_Y	34_G	0.586	0.60
9_F	42_L	0.585	0.60
15_W	19_F	0.581	0.60
21_V	40_F	0.578	0.59
14_N	19_F	0.571	0.58
19_F	45_P	0.570	0.58
17_D	20_E	0.568	0.58
35_T	38_L	0.566	0.58
29_P	67_L	0.565	0.58
16_D	47_Y	0.563	0.57
15_W	39_I	0.560	0.57
5_E	29_P	0.559	0.57
15_W	18_G	0.554	0.56
68_L	74_R	0.550	0.56
9_F	12_N	0.549	0.56
58_P	62_R	0.548	0.55
15_W	42_L	0.544	0.55
69_K	73_E	0.544	0.55
3_P	6_L	0.543	0.55
19_F	63_E	0.535	0.54
36_A	39_I	0.532	0.53
3_P	73_E	0.526	0.52
22_L	43_A	0.526	0.52
6_L	25_I	0.523	0.52
10_A	22_L	0.521	0.52
36_A	74_R	0.520	0.52
4_E	8_L	0.512	0.51
63_E	68_L	0.507	0.50
59_D	62_R	0.506	0.50
20_E	56_E	0.504	0.49
37_L	75_I	0.504	0.49
15_W	67_L	0.501	0.49
50_Q	73_E	0.500	0.49

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3waiA	1	0.8684	8.6	0.896	Contact Map
3ru6A	2	0	4.4	0.909	Contact Map
2lgzA	1	0.8158	3.1	0.916	Contact Map
2d1gA	2	0.9079	3	0.916	Contact Map
2kr1A	1	0.1842	3	0.916	Contact Map
2itbA	2	0.8947	2.9	0.917	Contact Map
2uv8G	3	1	2.6	0.919	Contact Map
2qtlA	1	1	2.4	0.92	Contact Map
1rjdA	1	0.3421	2.4	0.921	Contact Map
1f5qB	1	0.3947	2.3	0.921	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0046 seconds.