DUF4268 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF4268 - Domain of unknown function (DUF4268)

PFAM:	PF14088	Sequences: LRLEFWTAFLEYLKEKTSLFRNRKPSPQNWINYSTGISGFHLSFVFNKKKARVELYIDRGDKEENKEIFDQLEALKEEIEKEFGEELEWERLDDKKASRISRIYVELGGVDIFDEEDWPEIIEWLIERMIKFEKAFKPYI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	140 (138)
Sequences:	7877 (6585)
Seq/√Len:	560.6
META:	0.907

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
8_A	122_I	3.475	1.00
4_E	115_E	3.409	1.00
73_E	76_K	2.934	1.00
70_D	91_R	2.856	1.00
133_E	137_K	2.728	1.00
75_L	139_Y	2.565	1.00
117_D	120_E	2.428	1.00
5_F	125_L	2.206	1.00
75_L	78_E	2.164	1.00
44_F	129_M	2.108	1.00
12_Y	122_I	2.105	1.00
76_K	80_E	2.071	1.00
35_T	42_L	2.012	1.00
128_R	131_K	1.902	1.00
56_Y	97_A	1.815	1.00
12_Y	123_E	1.798	1.00
85_E	128_R	1.787	1.00
45_V	52_R	1.781	1.00
115_E	118_W	1.712	1.00
127_E	131_K	1.672	1.00
57_I	68_I	1.659	1.00
47_N	50_K	1.650	1.00
114_D	117_D	1.636	1.00
70_D	73_E	1.569	1.00
37_I	40_F	1.567	1.00
82_E	139_Y	1.559	1.00
5_F	121_I	1.546	1.00
80_E	86_E	1.512	1.00
59_R	64_E	1.474	1.00
44_F	125_L	1.471	1.00
58_D	96_K	1.454	1.00
78_E	82_E	1.448	1.00
117_D	121_I	1.443	1.00
67_E	71_Q	1.430	1.00
40_F	68_I	1.401	1.00
82_E	138_P	1.383	1.00
110_V	121_I	1.370	1.00
85_E	102_R	1.337	1.00
9_F	44_F	1.306	1.00
51_A	121_I	1.295	1.00
43_S	54_E	1.294	1.00
85_E	131_K	1.292	1.00
3_L	7_T	1.290	1.00
71_Q	74_A	1.290	1.00
53_V	132_F	1.289	1.00
123_E	127_E	1.277	1.00
66_K	70_D	1.277	1.00
83_F	102_R	1.273	1.00
32_N	43_S	1.273	1.00
12_Y	126_I	1.260	1.00
88_E	101_S	1.240	1.00
66_K	91_R	1.235	1.00
47_N	52_R	1.235	1.00
90_E	101_S	1.230	1.00
83_F	87_L	1.223	1.00
59_R	68_I	1.212	1.00
102_R	128_R	1.173	1.00
131_K	134_K	1.161	1.00
45_V	54_E	1.161	1.00
3_L	27_P	1.153	1.00
32_N	41_H	1.108	1.00
66_K	98_S	1.108	1.00
69_F	73_E	1.099	1.00
33_Y	44_F	1.095	1.00
12_Y	16_K	1.093	1.00
92_L	95_K	1.092	1.00
10_L	14_K	1.092	1.00
90_E	99_R	1.086	1.00
126_I	130_I	1.083	1.00
8_A	118_W	1.054	1.00
57_I	72_L	1.048	1.00
130_I	134_K	1.023	1.00
130_I	133_E	1.004	1.00
64_E	68_I	0.996	1.00
92_L	99_R	0.992	1.00
82_E	135_A	0.987	1.00
12_Y	15_E	0.975	1.00
83_F	135_A	0.972	1.00
124_W	128_R	0.970	1.00
122_I	125_L	0.970	1.00
8_A	119_P	0.970	1.00
77_E	81_K	0.964	1.00
71_Q	75_L	0.960	1.00
121_I	125_L	0.950	1.00
119_P	123_E	0.949	1.00
9_F	122_I	0.940	1.00
83_F	131_K	0.935	1.00
4_E	8_A	0.926	1.00
9_F	13_L	0.925	1.00
7_T	11_E	0.925	1.00
51_A	125_L	0.923	1.00
82_E	134_K	0.922	1.00
87_L	132_F	0.910	1.00
33_Y	129_M	0.906	1.00
46_F	112_I	0.887	1.00
12_Y	119_P	0.860	1.00
2_R	28_Q	0.852	1.00
107_L	110_V	0.841	1.00
92_L	97_A	0.840	1.00
6_W	9_F	0.834	1.00
54_E	99_R	0.832	1.00
43_S	56_Y	0.822	1.00
8_A	11_E	0.821	1.00
64_E	67_E	0.813	1.00
48_K	51_A	0.812	1.00
83_F	128_R	0.812	1.00
69_F	89_W	0.808	1.00
80_E	87_L	0.794	1.00
91_R	98_S	0.790	1.00
118_W	122_I	0.787	1.00
50_K	103_I	0.783	1.00
16_K	130_I	0.781	1.00
29_N	45_V	0.779	1.00
13_L	126_I	0.763	1.00
10_L	31_I	0.761	1.00
6_W	125_L	0.758	1.00
23_R	31_I	0.758	1.00
4_E	7_T	0.750	1.00
8_A	12_Y	0.750	1.00
84_G	131_K	0.749	1.00
42_L	137_K	0.747	1.00
17_T	20_F	0.746	1.00
17_T	130_I	0.740	1.00
78_E	81_K	0.737	1.00
35_T	40_F	0.736	1.00
62_K	66_K	0.728	1.00
19_L	133_E	0.721	1.00
13_L	20_F	0.718	1.00
7_T	25_P	0.715	1.00
42_L	129_M	0.714	1.00
80_E	84_G	0.709	1.00
35_T	55_L	0.696	1.00
122_I	126_I	0.688	1.00
84_G	87_L	0.685	1.00
9_F	12_Y	0.684	1.00
20_F	44_F	0.681	1.00
2_R	27_P	0.680	1.00
51_A	124_W	0.673	1.00
34_S	38_S	0.670	1.00
76_K	89_W	0.668	1.00
52_R	103_I	0.657	1.00
73_E	91_R	0.656	1.00
16_K	127_E	0.653	1.00
112_I	121_I	0.653	1.00
78_E	139_Y	0.643	1.00
104_Y	124_W	0.643	1.00
79_I	135_A	0.641	1.00
104_Y	120_E	0.635	1.00
54_E	101_S	0.629	1.00
92_L	98_S	0.628	1.00
132_F	136_F	0.627	1.00
77_E	80_E	0.625	1.00
70_D	93_D	0.621	1.00
59_R	65_N	0.620	1.00
94_D	98_S	0.618	1.00
37_I	68_I	0.617	1.00
49_K	111_D	0.615	1.00
11_E	14_K	0.609	1.00
107_L	120_E	0.607	1.00
58_D	97_A	0.594	1.00
3_L	25_P	0.593	1.00
111_D	114_D	0.593	1.00
13_L	129_M	0.593	1.00
2_R	26_S	0.589	1.00
7_T	10_L	0.589	1.00
120_E	124_W	0.582	1.00
123_E	126_I	0.579	1.00
131_K	135_A	0.577	1.00
42_L	133_E	0.577	1.00
40_F	57_I	0.574	0.99
40_F	55_L	0.572	0.99
16_K	123_E	0.571	0.99
39_G	65_N	0.566	0.99
73_E	77_E	0.564	0.99
50_K	106_E	0.562	0.99
128_R	132_F	0.559	0.99
120_E	123_E	0.556	0.99
76_K	79_I	0.555	0.99
53_V	128_R	0.553	0.99
70_D	74_A	0.552	0.99
80_E	89_W	0.552	0.99
127_E	134_K	0.551	0.99
135_A	139_Y	0.549	0.99
23_R	32_N	0.541	0.99
55_L	136_F	0.540	0.99
58_D	65_N	0.540	0.99
9_F	129_M	0.539	0.99
60_G	96_K	0.538	0.99
121_I	124_W	0.535	0.99
68_I	71_Q	0.534	0.99
83_F	132_F	0.532	0.99
61_D	64_E	0.532	0.99
44_F	53_V	0.523	0.99
95_K	98_S	0.521	0.99
79_I	89_W	0.518	0.99
136_F	139_Y	0.517	0.99
79_I	87_L	0.515	0.99
10_L	13_L	0.515	0.99
34_S	37_I	0.511	0.99
9_F	125_L	0.511	0.99
13_L	22_N	0.511	0.99
28_Q	32_N	0.510	0.99
23_R	33_Y	0.509	0.99
17_T	22_N	0.506	0.99
2_R	46_F	0.503	0.99
125_L	129_M	0.502	0.99
4_E	118_W	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2mc8A	1	0.3929	3.9	0.916	Contact Map
4exbA	2	0.5071	2.8	0.922	Contact Map
3odnA	1	0.5357	2.6	0.923	Contact Map
3zqsA	3	0.6857	2.5	0.924	Contact Map
4a1nA	2	0.9714	2.1	0.927	Contact Map
4e1pA	2	0.2929	1.7	0.93	Contact Map
3sscA	1	0.9143	1.7	0.93	Contact Map
4pqzA	1	0.5786	1.7	0.931	Contact Map
1di1A	1	0.9357	1.7	0.931	Contact Map
1dosA	2	0.3929	1.6	0.931	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.