DUF4256 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF4256 - Protein of unknown function (DUF4256)

PFAM:	PF14066	Sequences: LLKTLKARFEKNMNRHKGLEWAKVQAKLEANPEKLWSLNEMERTGGEPDVVGYDKKTGEYIFYDCSAESPKGRRSLCYDREALESRKEHKPKNSAVDMAAAMGIELLTEEQYRELQKLGEFDTKTSSWVKTPADIRKLGGALFCDRRYDTVFVYHNGAESYYAARGFRGSLRV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	173 (173)
Sequences:	6137 (2598)
Seq/√Len:	197.5
META:	0.899

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
80_R	97_D	3.904	1.00
129_V	144_C	3.835	1.00
104_I	169_G	3.641	1.00
80_R	84_E	3.563	1.00
114_E	117_K	3.400	1.00
40_E	43_R	3.219	1.00
25_Q	29_E	3.131	1.00
144_C	153_V	3.076	1.00
51_V	63_Y	2.842	1.00
94_S	97_D	2.731	1.00
76_L	93_N	2.616	1.00
76_L	98_M	2.504	1.00
135_I	150_T	2.488	1.00
93_N	97_D	2.480	1.00
146_R	149_D	2.401	1.00
20_E	23_K	2.398	1.00
134_D	149_D	2.309	1.00
120_E	146_R	2.273	1.00
83_L	94_S	2.246	1.00
111_Q	170_S	2.199	1.00
6_K	10_E	2.190	1.00
134_D	150_T	2.181	1.00
105_E	130_K	2.142	1.00
123_T	146_R	2.103	1.00
142_L	153_V	2.102	1.00
145_D	154_Y	2.078	1.00
129_V	142_L	2.045	1.00
53_Y	58_G	1.929	1.00
6_K	25_Q	1.914	1.00
83_L	90_K	1.910	1.00
68_E	123_T	1.796	1.00
68_E	124_K	1.668	1.00
59_E	172_R	1.638	1.00
84_E	90_K	1.633	1.00
93_N	101_A	1.623	1.00
143_F	154_Y	1.619	1.00
113_R	150_T	1.592	1.00
52_G	61_I	1.549	1.00
36_W	40_E	1.540	1.00
96_V	106_L	1.534	1.00
85_S	159_E	1.531	1.00
88_E	159_E	1.528	1.00
95_A	106_L	1.510	1.00
39_N	43_R	1.488	1.00
145_D	155_H	1.447	1.00
36_W	39_N	1.436	1.00
37_S	102_M	1.431	1.00
76_L	95_A	1.429	1.00
19_L	24_V	1.427	1.00
120_E	123_T	1.413	1.00
14_N	119_G	1.400	1.00
69_S	164_A	1.389	1.00
82_A	159_E	1.358	1.00
109_E	113_R	1.339	1.00
63_Y	170_S	1.337	1.00
78_Y	130_K	1.286	1.00
80_R	94_S	1.265	1.00
75_S	163_A	1.264	1.00
51_V	65_C	1.221	1.00
90_K	159_E	1.206	1.00
82_A	90_K	1.194	1.00
130_K	133_A	1.186	1.00
83_L	97_D	1.181	1.00
131_T	141_A	1.167	1.00
38_L	62_F	1.145	1.00
108_T	111_Q	1.123	1.00
53_Y	60_Y	1.099	1.00
93_N	98_M	1.094	1.00
23_K	53_Y	1.092	1.00
85_S	90_K	1.063	1.00
81_E	85_S	1.061	1.00
82_A	94_S	1.051	1.00
97_D	101_A	1.034	1.00
89_H	93_N	1.030	1.00
111_Q	114_E	1.016	1.00
68_E	74_R	1.000	1.00
74_R	163_A	0.987	1.00
34_K	59_E	0.982	1.00
110_E	114_E	0.960	0.99
138_L	150_T	0.951	0.99
135_I	142_L	0.951	0.99
120_E	149_D	0.949	0.99
38_L	171_L	0.948	0.99
148_Y	157_G	0.941	0.99
52_G	114_E	0.929	0.99
15_R	49_D	0.916	0.99
133_A	137_K	0.910	0.99
74_R	125_T	0.905	0.99
108_T	130_K	0.896	0.99
129_V	153_V	0.885	0.99
132_P	135_I	0.879	0.99
71_K	75_S	0.878	0.99
37_S	171_L	0.876	0.99
113_R	143_F	0.873	0.99
54_D	57_T	0.868	0.99
17_K	55_K	0.864	0.99
138_L	149_D	0.863	0.99
80_R	93_N	0.862	0.99
51_V	170_S	0.860	0.99
118_L	121_F	0.859	0.99
148_Y	164_A	0.849	0.99
69_S	75_S	0.838	0.98
89_H	161_Y	0.837	0.98
144_C	150_T	0.836	0.98
113_R	153_V	0.821	0.98
63_Y	114_E	0.803	0.98
16_H	49_D	0.803	0.98
110_E	117_K	0.796	0.98
16_H	50_V	0.790	0.98
109_E	150_T	0.788	0.98
22_A	26_A	0.787	0.98
102_M	169_G	0.780	0.97
83_L	93_N	0.778	0.97
90_K	161_Y	0.776	0.97
95_A	99_A	0.771	0.97
3_K	6_K	0.767	0.97
157_G	160_S	0.762	0.97
22_A	25_Q	0.761	0.97
45_G	71_K	0.761	0.97
155_H	162_Y	0.760	0.97
69_S	125_T	0.758	0.97
27_K	58_G	0.756	0.97
71_K	88_E	0.754	0.97
69_S	74_R	0.745	0.97
63_Y	107_L	0.737	0.96
134_D	138_L	0.736	0.96
87_K	161_Y	0.734	0.96
41_M	169_G	0.734	0.96
61_I	172_R	0.730	0.96
23_K	26_A	0.727	0.96
105_E	111_Q	0.723	0.96
26_A	29_E	0.714	0.96
144_C	159_E	0.711	0.96
75_S	88_E	0.704	0.95
88_E	92_K	0.697	0.95
98_M	101_A	0.694	0.95
96_V	100_A	0.694	0.95
134_D	137_K	0.692	0.95
40_E	102_M	0.690	0.95
54_D	172_R	0.690	0.95
76_L	82_A	0.684	0.95
36_W	43_R	0.681	0.95
23_K	60_Y	0.677	0.94
27_K	53_Y	0.674	0.94
61_I	170_S	0.666	0.94
87_K	90_K	0.665	0.94
143_F	162_Y	0.663	0.94
84_E	97_D	0.661	0.94
77_C	86_R	0.660	0.94
71_K	89_H	0.660	0.94
144_C	151_V	0.656	0.93
24_V	60_Y	0.652	0.93
55_K	58_G	0.651	0.93
113_R	154_Y	0.650	0.93
13_M	18_G	0.650	0.93
143_F	148_Y	0.646	0.93
78_Y	142_L	0.645	0.93
1_L	4_T	0.645	0.93
83_L	161_Y	0.637	0.92
108_T	170_S	0.635	0.92
94_S	98_M	0.633	0.92
81_E	137_K	0.630	0.92
67_A	123_T	0.629	0.92
108_T	129_V	0.623	0.91
37_S	40_E	0.622	0.91
31_N	34_K	0.621	0.91
27_K	60_Y	0.620	0.91
75_S	89_H	0.619	0.91
33_E	36_W	0.619	0.91
56_K	92_K	0.618	0.91
60_Y	173_V	0.617	0.91
95_A	164_A	0.615	0.91
139_G	159_E	0.615	0.91
68_E	125_T	0.614	0.91
37_S	104_I	0.612	0.91
89_H	159_E	0.611	0.91
14_N	120_E	0.611	0.91
155_H	160_S	0.610	0.91
160_S	163_A	0.607	0.90
55_K	61_I	0.607	0.90
85_S	89_H	0.601	0.90
3_K	7_A	0.601	0.90
81_E	84_E	0.601	0.90
157_G	161_Y	0.597	0.90
84_E	159_E	0.595	0.90
23_K	56_K	0.592	0.89
23_K	58_G	0.592	0.89
148_Y	159_E	0.590	0.89
147_R	155_H	0.590	0.89
98_M	167_F	0.587	0.89
126_S	154_Y	0.586	0.89
4_T	39_N	0.585	0.89
9_F	16_H	0.585	0.89
76_L	83_L	0.573	0.88
82_A	89_H	0.571	0.88
159_E	164_A	0.569	0.87
88_E	161_Y	0.567	0.87
75_S	83_L	0.561	0.87
84_E	94_S	0.561	0.87
12_N	49_D	0.558	0.86
64_D	73_R	0.556	0.86
80_R	101_A	0.552	0.86
93_N	96_V	0.550	0.86
146_R	151_V	0.548	0.85
13_M	20_E	0.547	0.85
78_Y	96_V	0.547	0.85
53_Y	57_T	0.547	0.85
3_K	25_Q	0.546	0.85
92_K	159_E	0.545	0.85
2_L	35_L	0.542	0.85
77_C	83_L	0.542	0.85
74_R	113_R	0.540	0.85
113_R	144_C	0.540	0.85
62_F	173_V	0.539	0.84
81_E	159_E	0.539	0.84
93_N	161_Y	0.539	0.84
159_E	163_A	0.538	0.84
107_L	170_S	0.536	0.84
148_Y	154_Y	0.535	0.84
80_R	85_S	0.535	0.84
13_M	19_L	0.533	0.84
46_G	64_D	0.532	0.84
152_F	156_N	0.531	0.84
68_E	71_K	0.531	0.84
123_T	149_D	0.530	0.83
63_Y	111_Q	0.529	0.83
76_L	92_K	0.528	0.83
7_A	110_E	0.526	0.83
12_N	16_H	0.525	0.83
79_D	82_A	0.524	0.83
67_A	119_G	0.524	0.83
68_E	120_E	0.522	0.83
87_K	126_S	0.522	0.83
71_K	74_R	0.521	0.82
126_S	161_Y	0.521	0.82
115_L	119_G	0.519	0.82
117_K	121_F	0.517	0.82
113_R	129_V	0.517	0.82
6_K	22_A	0.515	0.82
96_V	130_K	0.514	0.82
131_T	144_C	0.513	0.81
7_A	11_K	0.513	0.81
27_K	57_T	0.510	0.81
52_G	118_L	0.510	0.81
83_L	89_H	0.510	0.81
46_G	73_R	0.508	0.81
85_S	161_Y	0.507	0.81
10_E	13_M	0.507	0.81
34_K	43_R	0.506	0.81
54_D	118_L	0.506	0.81
162_Y	165_R	0.506	0.81
12_N	15_R	0.505	0.80
105_E	170_S	0.505	0.80
105_E	108_T	0.505	0.80
106_L	126_S	0.503	0.80
109_E	129_V	0.503	0.80
63_Y	119_G	0.503	0.80
81_E	133_A	0.502	0.80
52_G	58_G	0.501	0.80
143_F	155_H	0.500	0.80

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2y8tB	1	0.2081	34.5	0.959	Contact Map
1o7bT	1	0.5145	33.3	0.96	Contact Map
4recA	2	0.5376	31	0.96	Contact Map
1ob8A	1	0.7283	26.9	0.961	Contact Map
2eo0A	2	0.6994	18.3	0.964	Contact Map
1gefA	2	0.5723	17	0.965	Contact Map
1xmxA	2	0.7225	16.3	0.965	Contact Map
3pjxA	1	0.659	12.9	0.967	Contact Map
1dgsA	1	0.1329	12.8	0.967	Contact Map
4otmA	2	0.3526	12.2	0.967	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0065 seconds.