Lipoprotein_21 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Lipoprotein_21 - LppP/LprE lipoprotein

PFAM:	PF14041	Sequences: SNYDPCATLSWVLVGTAGDGMCRPYQAFFFVGGRFAGTDSPDPSASIGRVVLQGDDTVTLEYARYRPGDPLCCPSGTATVRFRWDGS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	87 (79)
Sequences:	2027 (1346)
Seq/√Len:	151.4
META:	0.857

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
62_Y	82_F	3.965	1.00
27_A	60_L	2.852	1.00
61_E	77_T	2.738	1.00
31_V	36_A	2.410	1.00
39_D	62_Y	2.117	1.00
69_D	75_S	2.065	1.00
57_T	83_R	2.044	1.00
61_E	79_T	1.785	1.00
31_V	84_W	1.756	1.00
69_D	74_P	1.705	1.00
51_V	61_E	1.704	1.00
66_R	75_S	1.586	1.00
39_D	44_S	1.576	1.00
59_T	81_R	1.573	1.00
21_M	71_L	1.571	1.00
54_G	57_T	1.532	1.00
19_D	22_C	1.526	1.00
66_R	76_G	1.456	1.00
20_G	23_R	1.430	1.00
19_D	23_R	1.387	1.00
49_R	61_E	1.378	1.00
7_A	10_S	1.356	1.00
70_P	73_C	1.322	1.00
25_Y	47_I	1.306	1.00
26_Q	38_T	1.305	1.00
57_T	81_R	1.287	1.00
23_R	71_L	1.274	1.00
8_T	32_G	1.261	1.00
21_M	25_Y	1.196	1.00
35_F	38_T	1.178	1.00
64_R	76_G	1.139	1.00
19_D	24_P	1.133	1.00
12_V	15_G	1.128	1.00
83_R	86_G	1.083	0.99
65_Y	69_D	1.082	0.99
53_Q	58_V	1.081	0.99
26_Q	39_D	1.070	0.99
47_I	63_A	1.063	0.99
72_C	75_S	0.972	0.99
26_Q	43_P	0.953	0.98
6_C	10_S	0.951	0.98
36_A	41_P	0.923	0.98
44_S	64_R	0.922	0.98
38_T	41_P	0.905	0.98
10_S	82_F	0.898	0.98
65_Y	74_P	0.888	0.97
53_Q	56_D	0.884	0.97
69_D	72_C	0.879	0.97
31_V	34_R	0.863	0.97
59_T	79_T	0.847	0.97
27_A	39_D	0.839	0.96
46_S	71_L	0.836	0.96
8_T	55_D	0.833	0.96
15_G	19_D	0.819	0.96
52_L	59_T	0.817	0.96
26_Q	33_G	0.817	0.96
53_Q	57_T	0.815	0.96
28_F	65_Y	0.811	0.96
13_L	16_T	0.809	0.95
27_A	42_D	0.808	0.95
78_A	81_R	0.807	0.95
51_V	59_T	0.799	0.95
18_G	55_D	0.794	0.95
10_S	33_G	0.793	0.95
30_F	35_F	0.790	0.95
51_V	55_D	0.785	0.95
52_L	58_V	0.778	0.94
27_A	50_V	0.776	0.94
21_M	24_P	0.768	0.94
15_G	28_F	0.767	0.94
20_G	71_L	0.767	0.94
12_V	17_A	0.766	0.94
36_A	39_D	0.765	0.94
77_T	81_R	0.765	0.94
56_D	83_R	0.759	0.94
10_S	13_L	0.759	0.94
69_D	73_C	0.757	0.94
40_S	82_F	0.740	0.93
71_L	75_S	0.726	0.92
40_S	43_P	0.723	0.92
22_C	35_F	0.709	0.91
14_V	27_A	0.707	0.91
29_F	39_D	0.699	0.91
14_V	60_L	0.688	0.90
28_F	31_V	0.684	0.90
52_L	55_D	0.678	0.89
27_A	58_V	0.669	0.89
66_R	69_D	0.660	0.88
51_V	81_R	0.657	0.88
50_V	54_G	0.656	0.88
20_G	46_S	0.649	0.87
51_V	63_A	0.648	0.87
44_S	47_I	0.644	0.87
8_T	31_V	0.642	0.87
28_F	44_S	0.642	0.87
47_I	57_T	0.639	0.86
46_S	63_A	0.637	0.86
37_G	40_S	0.615	0.84
64_R	78_A	0.610	0.84
49_R	58_V	0.610	0.84
10_S	15_G	0.607	0.83
29_F	64_R	0.592	0.82
10_S	31_V	0.589	0.81
44_S	62_Y	0.589	0.81
40_S	44_S	0.588	0.81
63_A	77_T	0.585	0.81
24_P	46_S	0.567	0.79
47_I	60_L	0.561	0.78
26_Q	44_S	0.555	0.78
7_A	13_L	0.548	0.77
17_A	24_P	0.548	0.77
13_L	17_A	0.541	0.76
33_G	56_D	0.533	0.75
45_A	55_D	0.533	0.75
20_G	24_P	0.514	0.72
52_L	57_T	0.514	0.72
35_F	41_P	0.506	0.71
13_L	58_V	0.500	0.70

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2zf9A	1	0.8621	4.4	0.916	Contact Map
2yoyA	1	0.7816	4.3	0.916	Contact Map
4iu3A	1	0.7931	3.9	0.918	Contact Map
3n2zB	2	0.977	3.1	0.922	Contact Map
4qtqA	1	0.8966	3	0.923	Contact Map
3d7rA	1	0.931	2.9	0.923	Contact Map
4l3nA	1	0.7701	2.9	0.923	Contact Map
3lsoA	1	0.9195	2.9	0.924	Contact Map
2pqfA	2	0.8276	2.8	0.924	Contact Map
4a02A	1	0.7931	2.7	0.925	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0048 seconds.