Spore_YtrH - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Spore_YtrH - Sporulation protein YtrH

PFAM:	PF14034	Sequences: KLILDFFIAFGVVLGGSLIGGLGAFLTGQPPLTTMLRLAESLKIWAIVAAIGGTFDTIRVIESGLFEGELSDLIKQILYILSAFLGAHTGYLLIKWLTG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	99 (99)
Sequences:	557 (371)
Seq/√Len:	37.3
META:	0.578

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
16_G	42_L	4.464	1.00
56_D	96_W	2.906	1.00
44_I	48_V	2.805	1.00
6_F	89_T	2.579	1.00
20_G	38_L	2.239	0.99
2_L	82_S	2.222	0.99
43_K	87_A	2.162	0.99
42_L	49_A	1.963	0.98
10_F	14_L	1.937	0.98
12_V	49_A	1.855	0.98
23_G	47_I	1.762	0.97
77_I	81_L	1.755	0.97
13_V	17_S	1.673	0.96
9_A	71_S	1.608	0.95
10_F	90_G	1.606	0.95
37_R	41_S	1.601	0.94
88_H	92_L	1.594	0.94
12_V	80_I	1.550	0.93
29_Q	73_L	1.515	0.93
49_A	56_D	1.478	0.92
48_V	58_I	1.465	0.91
24_A	74_I	1.463	0.91
24_A	34_T	1.414	0.90
96_W	99_G	1.405	0.89
47_I	51_I	1.403	0.89
5_D	51_I	1.382	0.89
61_I	84_F	1.343	0.87
39_A	43_K	1.332	0.87
29_Q	34_T	1.313	0.86
55_F	64_G	1.307	0.86
29_Q	65_L	1.291	0.85
29_Q	37_R	1.289	0.85
54_T	80_I	1.279	0.84
46_A	90_G	1.219	0.81
21_G	24_A	1.206	0.81
38_L	42_L	1.183	0.79
9_A	13_V	1.156	0.78
10_F	19_I	1.142	0.77
39_A	91_Y	1.141	0.77
84_F	90_G	1.139	0.77
10_F	93_L	1.133	0.76
54_T	66_F	1.096	0.74
33_T	37_R	1.094	0.74
3_I	66_F	1.085	0.73
2_L	78_L	1.067	0.72
77_I	80_I	1.066	0.72
40_E	59_R	1.059	0.71
39_A	94_I	1.057	0.71
70_L	74_I	1.044	0.70
22_L	25_F	1.015	0.68
59_R	79_Y	1.013	0.68
55_F	58_I	0.990	0.66
78_L	82_S	0.978	0.65
12_V	87_A	0.966	0.64
21_G	91_Y	0.963	0.64
35_M	94_I	0.946	0.63
42_L	75_K	0.943	0.62
21_G	35_M	0.943	0.62
1_K	63_S	0.918	0.60
43_K	88_H	0.903	0.59
54_T	75_K	0.896	0.58
32_L	42_L	0.891	0.58
66_F	69_E	0.882	0.57
17_S	42_L	0.881	0.57
13_V	61_I	0.877	0.57
31_P	43_K	0.872	0.56
19_I	38_L	0.853	0.55
16_G	69_E	0.853	0.55
88_H	91_Y	0.851	0.54
12_V	58_I	0.849	0.54
65_L	85_L	0.836	0.53
11_G	15_G	0.824	0.52
54_T	57_T	0.823	0.52
64_G	73_L	0.822	0.52
28_G	55_F	0.814	0.51
6_F	68_G	0.809	0.51
21_G	94_I	0.798	0.50
14_L	36_L	0.797	0.50
20_G	61_I	0.794	0.49
59_R	65_L	0.793	0.49
61_I	93_L	0.788	0.49
7_F	30_P	0.786	0.49
26_L	81_L	0.783	0.48
30_P	44_I	0.778	0.48
13_V	72_D	0.766	0.47
65_L	72_D	0.766	0.47
63_S	72_D	0.762	0.46
58_I	80_I	0.747	0.45
51_I	98_T	0.743	0.45
3_I	36_L	0.743	0.45
33_T	57_T	0.739	0.44
73_L	93_L	0.736	0.44
59_R	62_E	0.731	0.44
13_V	82_S	0.723	0.43
45_W	75_K	0.723	0.43
66_F	84_F	0.721	0.43
5_D	41_S	0.721	0.43
59_R	63_S	0.721	0.43
60_V	66_F	0.716	0.42
32_L	64_G	0.715	0.42
8_I	23_G	0.712	0.42
48_V	90_G	0.710	0.42
46_A	60_V	0.702	0.41
49_A	63_S	0.701	0.41
10_F	20_G	0.699	0.41
66_F	73_L	0.687	0.40
9_A	26_L	0.685	0.40
26_L	98_T	0.681	0.39
65_L	71_S	0.667	0.38
47_I	81_L	0.654	0.37
74_I	85_L	0.644	0.36
14_L	69_E	0.644	0.36
77_I	99_G	0.643	0.36
6_F	38_L	0.640	0.36
7_F	50_A	0.637	0.36
38_L	82_S	0.635	0.36
51_I	58_I	0.633	0.35
49_A	60_V	0.629	0.35
47_I	53_G	0.624	0.35
83_A	86_G	0.616	0.34
77_I	85_L	0.608	0.33
25_F	32_L	0.605	0.33
74_I	97_L	0.599	0.33
79_Y	82_S	0.596	0.33
17_S	67_E	0.595	0.32
58_I	82_S	0.590	0.32
1_K	79_Y	0.584	0.32
5_D	56_D	0.583	0.32
3_I	27_T	0.582	0.31
41_S	65_L	0.576	0.31
5_D	96_W	0.575	0.31
75_K	79_Y	0.573	0.31
59_R	70_L	0.571	0.31
69_E	85_L	0.555	0.29
63_S	73_L	0.555	0.29
2_L	79_Y	0.551	0.29
40_E	90_G	0.550	0.29
35_M	68_G	0.539	0.28
74_I	78_L	0.537	0.28
47_I	58_I	0.536	0.28
43_K	91_Y	0.535	0.28
17_S	89_T	0.534	0.28
30_P	46_A	0.531	0.28
19_I	93_L	0.521	0.27
17_S	76_Q	0.513	0.26
18_L	78_L	0.508	0.26
14_L	18_L	0.503	0.26
49_A	82_S	0.500	0.26

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3llqA	3	0.8788	3	0.945	Contact Map
3tdsE	3	0.404	2.8	0.946	Contact Map
4u2pA	4	0.9798	2.7	0.946	Contact Map
3zojA	3	0.8687	2.7	0.947	Contact Map
3kcuA	3	0.303	2.4	0.948	Contact Map
1geqA	1	0.4343	2.4	0.948	Contact Map
2ih3C	4	0.3333	2.4	0.948	Contact Map
4fc4A	3	0.2929	2.3	0.948	Contact Map
1q2zA	1	0.4646	2.2	0.949	Contact Map
1j4nA	4	0.8687	2.2	0.949	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0046 seconds.