DUF4231 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF4231 - Protein of unknown function (DUF4231)

PFAM:	PF14015	Sequences: DQISWYDRKARRNQRRYKRLRLILIVLAALIPVLAASLLGGGAPALAWVTAVLGALVAILAGLLQLFKYQENWIRYRATAEALKSEKWLYLARAGPYAGADDHEQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	105 (99)
Sequences:	7669 (6266)
Seq/√Len:	629.8
META:	0.922

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
86_E	97_Y	4.576	1.00
68_K	71_E	3.114	1.00
81_E	84_K	2.834	1.00
87_K	91_L	2.808	1.00
14_Q	18_K	2.700	1.00
95_G	98_A	2.340	1.00
33_V	55_A	2.002	1.00
12_R	16_R	1.879	1.00
7_D	80_A	1.751	1.00
7_D	84_K	1.716	1.00
4_S	8_R	1.704	1.00
22_L	63_L	1.684	1.00
78_A	82_A	1.673	1.00
21_R	24_L	1.643	1.00
63_L	67_F	1.613	1.00
24_L	28_A	1.594	1.00
77_R	81_E	1.587	1.00
88_W	92_A	1.545	1.00
35_A	50_T	1.521	1.00
9_K	12_R	1.517	1.00
48_W	52_V	1.515	1.00
80_A	84_K	1.451	1.00
7_D	11_R	1.437	1.00
89_L	95_G	1.425	1.00
32_P	35_A	1.404	1.00
36_A	51_A	1.376	1.00
73_W	77_R	1.343	1.00
3_I	80_A	1.333	1.00
10_A	14_Q	1.305	1.00
10_A	77_R	1.287	1.00
24_L	61_A	1.264	1.00
27_L	53_L	1.252	1.00
20_L	69_Y	1.240	1.00
50_T	54_G	1.232	1.00
9_K	76_Y	1.228	1.00
11_R	15_R	1.209	1.00
14_Q	17_Y	1.197	1.00
25_I	62_G	1.171	1.00
21_R	61_A	1.157	1.00
43_A	47_A	1.156	1.00
70_Q	74_I	1.129	1.00
16_R	19_R	1.105	1.00
85_S	89_L	1.098	1.00
51_A	55_A	1.079	1.00
27_L	60_L	1.070	1.00
33_V	51_A	1.067	1.00
11_R	14_Q	1.033	1.00
78_A	85_S	1.030	1.00
61_A	64_L	1.009	1.00
44_P	47_A	1.000	1.00
6_Y	79_T	0.992	1.00
88_W	91_L	0.990	1.00
29_A	59_I	0.988	1.00
23_I	27_L	0.972	1.00
8_R	12_R	0.970	1.00
72_N	76_Y	0.961	1.00
16_R	69_Y	0.957	1.00
20_L	60_L	0.956	1.00
21_R	64_L	0.954	1.00
21_R	25_I	0.941	1.00
3_I	7_D	0.939	1.00
31_I	54_G	0.939	1.00
62_G	66_L	0.920	1.00
86_E	89_L	0.907	1.00
84_K	88_W	0.900	1.00
5_W	9_K	0.881	1.00
59_I	63_L	0.877	1.00
19_R	22_L	0.872	1.00
83_L	87_K	0.870	1.00
5_W	76_Y	0.866	1.00
41_G	45_A	0.861	1.00
13_N	72_N	0.860	1.00
31_I	57_V	0.851	1.00
51_A	54_G	0.838	1.00
13_N	69_Y	0.834	1.00
39_L	42_G	0.820	1.00
71_E	75_R	0.816	1.00
38_L	42_G	0.792	1.00
54_G	58_A	0.770	1.00
15_R	19_R	0.768	1.00
58_A	61_A	0.766	1.00
10_A	17_Y	0.762	1.00
89_L	94_A	0.757	1.00
28_A	57_V	0.751	1.00
43_A	46_L	0.749	1.00
72_N	75_R	0.739	1.00
48_W	51_A	0.736	1.00
82_A	85_S	0.727	1.00
10_A	80_A	0.725	1.00
98_A	101_D	0.720	1.00
13_N	76_Y	0.717	1.00
3_I	6_Y	0.708	1.00
8_R	11_R	0.708	1.00
42_G	47_A	0.699	1.00
77_R	84_K	0.694	1.00
54_G	57_V	0.687	1.00
40_G	43_A	0.681	1.00
22_L	26_V	0.677	1.00
32_P	58_A	0.671	1.00
7_D	77_R	0.668	1.00
75_R	79_T	0.668	1.00
73_W	81_E	0.667	1.00
89_L	96_P	0.665	1.00
17_Y	70_Q	0.663	1.00
47_A	51_A	0.662	1.00
21_R	65_Q	0.659	1.00
4_S	7_D	0.649	1.00
52_V	55_A	0.648	1.00
39_L	44_P	0.644	1.00
22_L	67_F	0.643	1.00
20_L	64_L	0.642	1.00
24_L	60_L	0.640	1.00
7_D	14_Q	0.639	1.00
34_L	53_L	0.635	1.00
63_L	66_L	0.633	1.00
64_L	70_Q	0.628	1.00
31_I	53_L	0.627	1.00
63_L	69_Y	0.611	1.00
37_S	41_G	0.598	1.00
47_A	50_T	0.597	1.00
24_L	29_A	0.596	1.00
31_I	35_A	0.595	1.00
13_N	17_Y	0.589	1.00
61_A	65_Q	0.587	1.00
39_L	43_A	0.585	1.00
42_G	45_A	0.584	1.00
16_R	20_L	0.580	1.00
34_L	46_L	0.580	1.00
32_P	36_A	0.576	1.00
77_R	80_A	0.573	1.00
46_L	50_T	0.571	1.00
28_A	32_P	0.570	1.00
27_L	56_L	0.569	1.00
44_P	48_W	0.568	1.00
35_A	54_G	0.565	1.00
24_L	27_L	0.556	1.00
45_A	48_W	0.554	1.00
65_Q	70_Q	0.549	1.00
58_A	62_G	0.544	1.00
17_Y	64_L	0.541	0.99
64_L	69_Y	0.537	0.99
17_Y	66_L	0.530	0.99
7_D	10_A	0.520	0.99
65_Q	68_K	0.519	0.99
69_Y	72_N	0.516	0.99
6_Y	10_A	0.515	0.99
59_I	62_G	0.509	0.99
25_I	31_I	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4ev6A	3	0.6857	23.8	0.85	Contact Map
2m8rA	1	0.381	21.4	0.853	Contact Map
4i0uA	4	0.6667	20.4	0.855	Contact Map
3sokA	1	0.619	10.7	0.872	Contact Map
2j5uA	4	0.2667	8.3	0.878	Contact Map
2hi2A	1	0.5905	7.8	0.88	Contact Map
2m7gA	1	0.5619	6.3	0.884	Contact Map
1oqwA	1	0.6	5.5	0.888	Contact Map
3j01B	1	0.7429	3.9	0.896	Contact Map
4q4hB	1	0.9905	3.8	0.896	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0049 seconds.