RSN1_TM - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RSN1_TM - Late exocytosis, associated with Golgi transport

PFAM:	PF13967	Sequences: AFLTSLVINLVIFLVLLLLFSILRPRNPRVYAPRTYLKGESERTPPLPSKGFFGWIPPLLRTSEEELLQHAGLDAYVFLRFLRMLLKIFLVIALLSLPILLPVNATGGGGDDDDDDDSGLDRLTISNVPTGSNRLWAHVVFAYLFTGWVCYLLYRE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	156 (154)
Sequences:	2403 (1784)
Seq/√Len:	143.8
META:	0.217

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
104_N	138_H	7.685	1.00
88_I	149_V	4.871	1.00
51_G	54_G	3.618	1.00
106_T	134_R	3.473	1.00
103_V	137_A	2.922	1.00
57_P	61_R	2.710	1.00
96_S	145_F	2.620	1.00
151_Y	155_R	2.474	1.00
134_R	137_A	2.468	1.00
91_V	148_W	2.462	1.00
97_L	101_L	2.303	1.00
64_E	76_Y	2.116	1.00
146_T	150_C	2.023	1.00
40_E	43_R	1.998	1.00
44_T	47_L	1.980	1.00
15_V	19_L	1.897	1.00
95_L	141_F	1.897	1.00
68_L	76_Y	1.892	1.00
94_L	98_P	1.874	1.00
99_I	141_F	1.849	1.00
86_L	90_L	1.841	1.00
63_S	66_E	1.823	1.00
148_W	152_L	1.816	1.00
147_G	151_Y	1.802	1.00
139_V	143_Y	1.711	1.00
143_Y	147_G	1.686	1.00
19_L	23_L	1.586	1.00
48_P	51_G	1.555	1.00
101_L	123_L	1.547	1.00
96_S	141_F	1.505	1.00
84_M	152_L	1.499	1.00
98_P	102_P	1.479	1.00
99_I	102_P	1.435	1.00
92_I	145_F	1.421	1.00
55_W	74_D	1.372	1.00
11_V	14_L	1.366	1.00
66_E	69_Q	1.353	1.00
67_L	79_L	1.334	1.00
27_N	30_V	1.314	1.00
112_D	117_D	1.309	1.00
114_D	117_D	1.287	1.00
67_L	76_Y	1.269	1.00
100_L	104_N	1.232	1.00
41_S	47_L	1.231	1.00
7_V	11_V	1.229	1.00
87_K	155_R	1.219	1.00
113_D	117_D	1.217	1.00
143_Y	146_T	1.187	1.00
62_T	66_E	1.186	1.00
101_L	105_A	1.181	1.00
123_L	126_S	1.129	0.99
82_L	120_L	1.125	0.99
109_G	112_D	1.118	0.99
11_V	15_V	1.097	0.99
63_S	69_Q	1.087	0.99
112_D	115_D	1.086	0.99
123_L	127_N	1.084	0.99
25_P	34_R	1.077	0.99
95_L	144_L	1.076	0.99
44_T	48_P	1.066	0.99
107_G	127_N	1.060	0.99
136_W	140_V	1.037	0.99
91_V	152_L	1.035	0.99
120_L	123_L	1.027	0.99
85_L	89_F	1.020	0.99
119_G	123_L	1.012	0.99
42_E	45_P	1.011	0.99
67_L	71_A	0.998	0.99
59_L	78_F	0.988	0.98
13_F	16_L	0.988	0.98
27_N	31_Y	0.986	0.98
94_L	133_N	0.975	0.98
87_K	152_L	0.972	0.98
100_L	137_A	0.948	0.98
97_L	105_A	0.938	0.98
12_I	15_V	0.938	0.98
123_L	139_V	0.929	0.98
125_I	135_L	0.928	0.98
44_T	49_S	0.920	0.98
113_D	116_D	0.918	0.97
119_G	128_V	0.914	0.97
133_N	136_W	0.913	0.97
7_V	10_L	0.910	0.97
28_P	32_A	0.901	0.97
19_L	22_I	0.893	0.97
112_D	116_D	0.893	0.97
108_G	111_D	0.891	0.97
140_V	144_L	0.891	0.97
9_N	12_I	0.889	0.97
95_L	98_P	0.882	0.97
99_I	103_V	0.873	0.97
84_M	88_I	0.872	0.97
92_I	96_S	0.871	0.97
141_F	145_F	0.870	0.97
17_L	21_S	0.869	0.96
9_N	30_V	0.865	0.96
87_K	151_Y	0.860	0.96
136_W	139_V	0.857	0.96
89_F	92_I	0.854	0.96
4_T	8_I	0.845	0.96
42_E	47_L	0.843	0.96
14_L	133_N	0.834	0.96
33_P	36_Y	0.829	0.95
107_G	112_D	0.826	0.95
18_L	22_I	0.826	0.95
110_G	113_D	0.823	0.95
5_S	8_I	0.821	0.95
25_P	32_A	0.812	0.95
34_R	148_W	0.802	0.95
77_V	81_F	0.794	0.94
139_V	146_T	0.788	0.94
25_P	139_V	0.782	0.94
77_V	146_T	0.776	0.94
41_S	44_T	0.772	0.93
99_I	140_V	0.771	0.93
29_R	36_Y	0.768	0.93
4_T	75_A	0.768	0.93
88_I	91_V	0.767	0.93
105_A	123_L	0.753	0.92
124_T	127_N	0.752	0.92
93_A	97_L	0.749	0.92
6_L	118_S	0.749	0.92
139_V	150_C	0.748	0.92
42_E	69_Q	0.743	0.92
51_G	58_P	0.742	0.92
12_I	16_L	0.736	0.92
5_S	9_N	0.732	0.91
64_E	68_L	0.732	0.91
71_A	77_V	0.728	0.91
14_L	57_P	0.727	0.91
9_N	13_F	0.724	0.91
10_L	14_L	0.719	0.91
39_G	42_E	0.719	0.91
68_L	73_L	0.718	0.91
109_G	113_D	0.717	0.91
76_Y	81_F	0.714	0.90
90_L	94_L	0.714	0.90
100_L	138_H	0.710	0.90
107_G	135_L	0.708	0.90
21_S	53_F	0.708	0.90
106_T	113_D	0.696	0.89
86_L	89_F	0.695	0.89
56_I	60_L	0.695	0.89
21_S	52_F	0.695	0.89
40_E	65_E	0.690	0.89
21_S	25_P	0.690	0.89
88_I	92_I	0.690	0.89
89_F	93_A	0.690	0.89
88_I	148_W	0.687	0.89
5_S	16_L	0.685	0.88
64_E	83_R	0.685	0.88
87_K	136_W	0.682	0.88
22_I	25_P	0.677	0.88
2_F	6_L	0.675	0.88
73_L	85_L	0.675	0.88
9_N	16_L	0.673	0.88
77_V	86_L	0.670	0.87
82_L	100_L	0.668	0.87
8_I	48_P	0.664	0.87
43_R	70_H	0.659	0.86
3_L	7_V	0.656	0.86
31_Y	73_L	0.654	0.86
43_R	56_I	0.649	0.86
90_L	148_W	0.646	0.85
47_L	51_G	0.640	0.85
111_D	115_D	0.635	0.84
43_R	90_L	0.630	0.84
59_L	72_G	0.627	0.84
47_L	50_K	0.627	0.84
4_T	10_L	0.625	0.83
11_V	40_E	0.624	0.83
18_L	54_G	0.615	0.82
23_L	27_N	0.613	0.82
146_T	153_L	0.612	0.82
2_F	120_L	0.609	0.82
53_F	57_P	0.608	0.82
121_D	134_R	0.607	0.82
90_L	105_A	0.607	0.82
101_L	104_N	0.605	0.81
98_P	106_T	0.603	0.81
3_L	6_L	0.602	0.81
80_R	120_L	0.602	0.81
24_R	145_F	0.602	0.81
105_A	122_R	0.602	0.81
17_L	138_H	0.600	0.81
58_P	73_L	0.598	0.81
142_A	146_T	0.594	0.80
40_E	44_T	0.594	0.80
5_S	26_R	0.588	0.80
24_R	92_I	0.586	0.79
62_T	70_H	0.584	0.79
43_R	47_L	0.582	0.79
29_R	38_K	0.582	0.79
89_F	139_V	0.578	0.78
133_N	140_V	0.577	0.78
118_S	128_V	0.574	0.78
21_S	55_W	0.571	0.78
60_L	93_A	0.569	0.77
72_G	75_A	0.569	0.77
107_G	129_P	0.565	0.77
49_S	54_G	0.564	0.77
107_G	111_D	0.560	0.76
73_L	80_R	0.560	0.76
92_I	149_V	0.550	0.75
6_L	124_T	0.550	0.75
147_G	150_C	0.546	0.74
125_I	138_H	0.546	0.74
80_R	84_M	0.544	0.74
110_G	128_V	0.543	0.74
4_T	136_W	0.539	0.73
71_A	79_L	0.539	0.73
31_Y	72_G	0.538	0.73
45_P	49_S	0.537	0.73
59_L	75_A	0.536	0.73
66_E	70_H	0.534	0.73
14_L	151_Y	0.533	0.73
2_F	5_S	0.524	0.71
10_L	112_D	0.524	0.71
31_Y	34_R	0.523	0.71
81_F	102_P	0.521	0.71
16_L	146_T	0.521	0.71
116_D	130_T	0.516	0.70
28_P	36_Y	0.514	0.70
78_F	89_F	0.512	0.70
131_G	144_L	0.505	0.69
122_R	127_N	0.505	0.69
35_T	84_M	0.505	0.69
13_F	26_R	0.504	0.68
110_G	115_D	0.503	0.68
41_S	46_P	0.503	0.68
108_G	113_D	0.500	0.68

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4um9B	2	0	7.5	0.932	Contact Map
2m20A	2	0.3526	5.2	0.937	Contact Map
1pfiA	7	0.1667	4.2	0.94	Contact Map
4aw6A	2	0.9615	4.2	0.94	Contact Map
2ww9B	1	0.3654	3.9	0.941	Contact Map
4ryoA	1	0.4231	3.7	0.941	Contact Map
3ug9A	2	0.3782	3.6	0.942	Contact Map
2k1kA	2	0.1795	3.4	0.942	Contact Map
2jafA	3	0.2115	3.2	0.943	Contact Map
1v54A	1	0.391	2.6	0.946	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0064 seconds.