GUB_WAK_bind - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

GUB_WAK_bind - Wall-associated receptor kinase galacturonan-binding

PFAM:	PF13947	Sequences: KPGCPSKCGNVSIPYPFGIGPGCGLDPGFELTCNNSTGPPKLFLGSGNYEVLNISLENGTLRVSDPISSDCYNSSGSSSSNSSLSLTLPFFFSSTRNKFTVVGCNT	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	106 (104)
Sequences:	3479 (2746)
Seq/√Len:	269.3
META:	0.063

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
90_F	93_S	3.912	1.00
60_T	96_R	3.499	1.00
31_L	51_V	3.270	1.00
41_K	50_E	2.711	1.00
68_S	71_C	2.705	1.00
31_L	42_L	2.440	1.00
84_L	88_L	2.432	1.00
85_S	88_L	2.247	1.00
52_L	64_S	2.115	1.00
20_G	30_E	2.113	1.00
41_K	44_L	1.995	1.00
7_K	12_S	1.968	1.00
53_N	62_R	1.889	1.00
55_S	58_N	1.756	1.00
7_K	10_N	1.753	1.00
40_P	44_L	1.747	1.00
24_G	30_E	1.728	1.00
82_S	85_S	1.683	1.00
73_N	76_G	1.609	1.00
73_N	77_S	1.601	1.00
34_N	39_P	1.583	1.00
89_P	92_F	1.564	1.00
14_P	56_L	1.523	1.00
18_G	24_G	1.487	1.00
89_P	93_S	1.485	1.00
91_F	94_S	1.482	1.00
4_C	23_C	1.431	1.00
84_L	87_T	1.426	1.00
55_S	60_T	1.407	1.00
74_S	78_S	1.367	1.00
82_S	86_L	1.362	1.00
81_N	87_T	1.294	1.00
40_P	43_F	1.278	1.00
50_E	64_S	1.251	1.00
27_P	30_E	1.246	1.00
28_G	61_L	1.217	1.00
68_S	72_Y	1.199	1.00
62_R	65_D	1.191	1.00
90_F	94_S	1.150	1.00
81_N	84_L	1.145	1.00
6_S	14_P	1.128	1.00
5_P	20_G	1.124	1.00
5_P	19_I	1.069	1.00
83_S	88_L	1.061	1.00
52_L	62_R	1.048	1.00
76_G	79_S	1.042	1.00
49_Y	63_V	1.033	1.00
71_C	74_S	1.025	1.00
83_S	86_L	1.023	1.00
74_S	77_S	0.973	1.00
69_S	72_Y	0.972	1.00
38_G	42_L	0.970	1.00
14_P	18_G	0.960	1.00
39_P	43_F	0.957	1.00
11_V	59_G	0.934	1.00
18_G	103_G	0.934	1.00
56_L	61_L	0.925	1.00
78_S	81_N	0.920	1.00
73_N	78_S	0.914	1.00
34_N	37_T	0.906	1.00
18_G	22_G	0.900	1.00
7_K	11_V	0.900	1.00
81_N	88_L	0.898	1.00
39_P	42_L	0.894	1.00
51_V	54_I	0.879	1.00
81_N	85_S	0.868	1.00
69_S	74_S	0.868	1.00
60_T	71_C	0.855	1.00
73_N	79_S	0.853	1.00
19_I	31_L	0.846	1.00
83_S	87_T	0.841	1.00
78_S	82_S	0.840	1.00
67_I	72_Y	0.828	0.99
31_L	40_P	0.826	0.99
79_S	82_S	0.820	0.99
71_C	76_G	0.812	0.99
91_F	105_N	0.808	0.99
80_S	87_T	0.783	0.99
36_S	40_P	0.781	0.99
82_S	87_T	0.778	0.99
27_P	46_S	0.777	0.99
37_T	40_P	0.771	0.99
97_N	103_G	0.765	0.99
93_S	99_F	0.764	0.99
14_P	31_L	0.756	0.99
29_F	94_S	0.754	0.99
49_Y	65_D	0.741	0.99
61_L	66_P	0.739	0.99
82_S	88_L	0.735	0.99
51_V	61_L	0.731	0.99
57_E	95_T	0.728	0.99
61_L	65_D	0.713	0.98
94_S	97_N	0.711	0.98
75_S	78_S	0.710	0.98
6_S	12_S	0.710	0.98
70_D	75_S	0.705	0.98
21_P	30_E	0.700	0.98
9_G	23_C	0.698	0.98
13_I	19_I	0.694	0.98
60_T	64_S	0.693	0.98
12_S	58_N	0.691	0.98
98_K	101_V	0.682	0.98
70_D	77_S	0.680	0.98
55_S	62_R	0.676	0.98
76_G	80_S	0.667	0.98
8_C	16_P	0.667	0.98
35_N	39_P	0.666	0.97
68_S	73_N	0.660	0.97
36_S	41_K	0.660	0.97
21_P	48_N	0.656	0.97
72_Y	76_G	0.653	0.97
36_S	57_E	0.648	0.97
70_D	105_N	0.647	0.97
39_P	50_E	0.641	0.97
21_P	27_P	0.640	0.97
19_I	24_G	0.639	0.97
53_N	57_E	0.628	0.96
14_P	97_N	0.616	0.96
25_L	28_G	0.614	0.96
3_G	12_S	0.613	0.96
15_Y	97_N	0.610	0.96
11_V	42_L	0.595	0.95
29_F	33_C	0.595	0.95
56_L	59_G	0.585	0.95
10_N	20_G	0.580	0.94
26_D	94_S	0.573	0.94
58_N	64_S	0.570	0.94
72_Y	79_S	0.566	0.94
52_L	70_D	0.565	0.94
3_G	27_P	0.564	0.94
60_T	94_S	0.560	0.93
72_Y	75_S	0.553	0.93
5_P	26_D	0.548	0.93
2_P	57_E	0.541	0.92
84_L	96_R	0.530	0.91
2_P	63_V	0.529	0.91
101_V	104_C	0.528	0.91
14_P	90_F	0.526	0.91
5_P	32_T	0.525	0.91
86_L	89_P	0.524	0.91
61_L	78_S	0.524	0.91
4_C	9_G	0.519	0.91
59_G	62_R	0.517	0.90
3_G	52_L	0.512	0.90
70_D	73_N	0.511	0.90
32_T	45_G	0.510	0.90
92_F	97_N	0.508	0.90
58_N	91_F	0.508	0.90
62_R	86_L	0.508	0.90
80_S	84_L	0.506	0.89
24_G	27_P	0.506	0.89
3_G	6_S	0.502	0.89
24_G	105_N	0.501	0.89
11_V	46_S	0.501	0.89
72_Y	82_S	0.500	0.89
31_L	41_K	0.500	0.89

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2kdxA	1	0.4245	3	0.924	Contact Map
2cq7A	1	0.1604	2.4	0.928	Contact Map
2hm3A	1	0.1038	2	0.931	Contact Map
1oznA	1	0.8396	1.9	0.932	Contact Map
3j20W	1	0.3868	1.9	0.932	Contact Map
1n7dA	1	0.8491	1.7	0.934	Contact Map
4p8sA	1	0.8396	1.6	0.936	Contact Map
1dvpA	2	0.5566	1.5	0.936	Contact Map
3ml4A	2	0.5377	1.4	0.937	Contact Map
2id5A	3	0.8396	1.4	0.937	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0053 seconds.