Phage_gp49_66 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Phage_gp49_66 - Phage protein (N4 Gp49/phage Sf6 gene 66) family

PFAM:	PF13876	Sequences: VTPEDIEANIASEEYFTAPDGSLTTLTVCVLTLRNGFTVTGESACASPENFDAEIGRKIARENAVNKIWPLEGYLLKEKL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	80 (78)
Sequences:	2769 (1895)
Seq/√Len:	214.6
META:	0.891

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
53_A	57_R	2.680	1.00
7_E	65_V	2.603	1.00
13_E	61_R	2.543	1.00
58_K	62_E	2.290	1.00
75_L	78_E	2.217	1.00
67_K	70_P	2.036	1.00
5_D	8_A	1.965	1.00
42_E	67_K	1.957	1.00
4_E	8_A	1.945	1.00
9_N	72_E	1.863	1.00
72_E	75_L	1.796	1.00
55_I	59_I	1.712	1.00
63_N	66_N	1.711	1.00
9_N	34_R	1.693	1.00
6_I	68_I	1.592	1.00
5_D	9_N	1.459	1.00
62_E	66_N	1.441	1.00
26_L	38_T	1.437	1.00
3_P	7_E	1.421	1.00
14_E	32_T	1.398	1.00
30_V	38_T	1.370	1.00
33_L	68_I	1.356	1.00
11_A	34_R	1.354	1.00
54_E	58_K	1.333	1.00
55_I	58_K	1.332	1.00
42_E	63_N	1.326	1.00
26_L	30_V	1.283	1.00
54_E	57_R	1.263	1.00
3_P	65_V	1.253	1.00
46_A	77_K	1.238	1.00
61_R	65_V	1.230	1.00
19_P	24_T	1.175	1.00
75_L	79_K	1.121	1.00
47_S	50_N	1.057	1.00
29_C	61_R	1.037	1.00
4_E	7_E	1.032	1.00
9_N	75_L	1.027	1.00
9_N	74_Y	1.024	1.00
46_A	76_L	1.016	1.00
39_V	71_L	1.016	1.00
13_E	31_L	1.015	1.00
12_S	32_T	1.010	1.00
9_N	78_E	0.999	1.00
25_T	77_K	0.997	1.00
37_F	44_A	0.989	1.00
26_L	40_T	0.986	1.00
28_V	40_T	0.968	1.00
18_A	30_V	0.967	1.00
26_L	42_E	0.958	1.00
1_V	5_D	0.956	1.00
41_G	60_A	0.952	1.00
5_D	72_E	0.940	0.99
31_L	64_A	0.922	0.99
69_W	73_G	0.921	0.99
59_I	62_E	0.917	0.99
30_V	40_T	0.899	0.99
14_E	18_A	0.879	0.99
16_F	19_P	0.848	0.99
32_T	38_T	0.833	0.99
41_G	64_A	0.828	0.99
41_G	63_N	0.825	0.99
27_T	51_F	0.818	0.99
37_F	70_P	0.795	0.98
25_T	45_C	0.790	0.98
20_D	24_T	0.788	0.98
14_E	20_D	0.781	0.98
15_Y	61_R	0.770	0.98
15_Y	29_C	0.766	0.98
16_F	21_G	0.752	0.98
29_C	60_A	0.748	0.97
2_T	5_D	0.747	0.97
31_L	61_R	0.745	0.97
7_E	61_R	0.744	0.97
50_N	76_L	0.741	0.97
16_F	28_V	0.711	0.97
39_V	68_I	0.709	0.97
15_Y	57_R	0.706	0.96
16_F	30_V	0.701	0.96
38_T	45_C	0.688	0.96
16_F	20_D	0.685	0.96
17_T	57_R	0.682	0.96
62_E	65_V	0.679	0.96
27_T	60_A	0.672	0.95
26_L	44_A	0.667	0.95
25_T	48_P	0.659	0.95
17_T	53_A	0.652	0.95
18_A	26_L	0.651	0.94
63_N	67_K	0.650	0.94
59_I	63_N	0.649	0.94
18_A	28_V	0.647	0.94
73_G	76_L	0.642	0.94
42_E	45_C	0.637	0.94
6_I	72_E	0.629	0.93
18_A	21_G	0.614	0.93
45_C	51_F	0.607	0.92
37_F	43_S	0.591	0.91
14_E	21_G	0.589	0.91
29_C	57_R	0.588	0.91
10_I	13_E	0.579	0.90
10_I	65_V	0.576	0.90
9_N	33_L	0.573	0.90
52_D	55_I	0.571	0.90
18_A	24_T	0.559	0.89
25_T	38_T	0.544	0.87
42_E	60_A	0.541	0.87
50_N	69_W	0.539	0.87
29_C	64_A	0.536	0.87
68_I	72_E	0.516	0.84
37_F	71_L	0.515	0.84
16_F	24_T	0.514	0.84
60_A	64_A	0.512	0.84
37_F	46_A	0.509	0.84
45_C	77_K	0.508	0.83
42_E	70_P	0.504	0.83
25_T	46_A	0.503	0.83
17_T	21_G	0.500	0.83
17_T	20_D	0.500	0.83

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2pw9A	2	0.775	8.9	0.902	Contact Map
2fggA	2	0.9375	8.8	0.902	Contact Map
4pdeA	2	0.7	8.5	0.903	Contact Map
1v5eA	4	0.95	6.5	0.908	Contact Map
2jn4A	1	0.6	5.2	0.912	Contact Map
4kgdA	4	0.9375	5.2	0.912	Contact Map
4wpyA	2	0.9125	4.7	0.914	Contact Map
3cuqA	1	0.7	4.6	0.914	Contact Map
4espA	1	0.925	4.4	0.915	Contact Map
4v2xA	2	0.5375	4.3	0.915	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0045 seconds.