MBOAT_2 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MBOAT_2 - Membrane bound O-acyl transferase family

PFAM:	PF13813	Sequences: WPENFNSPYKATSITDFWGRRWHITLSRWLRDYLYIPLGGNRGGKARTYLNLLITFLLSGLWHGAGWSVPARGPGGPTLFFLL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	83 (65)
Sequences:	13642 (6166)
Seq/√Len:	764.7
META:	0.873

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
7_S	10_K	3.553	1.00
30_L	55_T	3.197	1.00
30_L	59_S	2.966	1.00
47_R	50_L	2.754	1.00
27_S	31_R	2.321	1.00
12_T	16_D	1.957	1.00
16_D	21_R	1.922	1.00
43_G	48_T	1.862	1.00
56_F	59_S	1.812	1.00
45_K	49_Y	1.808	1.00
16_D	20_R	1.661	1.00
23_H	26_L	1.604	1.00
24_I	28_R	1.502	1.00
3_E	6_N	1.464	1.00
46_A	50_L	1.403	1.00
15_T	56_F	1.363	1.00
24_I	27_S	1.300	1.00
44_G	48_T	1.282	1.00
46_A	49_Y	1.269	1.00
4_N	25_T	1.264	1.00
11_A	16_D	1.218	1.00
11_A	21_R	1.189	1.00
6_N	24_I	1.165	1.00
39_G	42_R	1.159	1.00
51_N	55_T	1.159	1.00
45_K	48_T	1.146	1.00
31_R	36_I	1.129	1.00
50_L	54_I	1.126	1.00
34_L	37_P	1.104	1.00
6_N	10_K	1.054	1.00
8_P	21_R	1.052	1.00
64_G	67_W	1.028	1.00
28_R	32_D	0.995	1.00
43_G	47_R	0.991	1.00
29_W	33_Y	0.987	1.00
53_L	57_L	0.976	1.00
39_G	51_N	0.971	1.00
36_I	41_N	0.967	1.00
55_T	59_S	0.958	1.00
38_L	54_I	0.950	1.00
36_I	40_G	0.922	1.00
3_E	7_S	0.899	1.00
43_G	50_L	0.874	1.00
42_R	50_L	0.836	1.00
30_L	34_L	0.830	1.00
34_L	38_L	0.818	1.00
34_L	58_L	0.816	1.00
48_T	59_S	0.815	1.00
36_I	39_G	0.804	1.00
47_R	51_N	0.792	1.00
52_L	55_T	0.783	1.00
25_T	28_R	0.779	1.00
33_Y	37_P	0.771	1.00
26_L	62_W	0.767	1.00
60_G	64_G	0.756	1.00
49_Y	52_L	0.750	1.00
32_D	36_I	0.725	1.00
48_T	52_L	0.713	1.00
15_T	48_T	0.712	1.00
56_F	63_H	0.704	1.00
3_E	10_K	0.698	1.00
7_S	59_S	0.692	1.00
48_T	56_F	0.683	1.00
38_L	42_R	0.679	1.00
20_R	24_I	0.677	1.00
43_G	51_N	0.677	1.00
26_L	30_L	0.652	1.00
29_W	32_D	0.649	1.00
25_T	29_W	0.632	1.00
43_G	46_A	0.630	1.00
39_G	47_R	0.627	1.00
35_Y	51_N	0.627	1.00
25_T	62_W	0.626	1.00
4_N	24_I	0.621	1.00
34_L	54_I	0.620	1.00
13_S	16_D	0.615	1.00
14_I	65_A	0.606	1.00
44_G	49_Y	0.599	1.00
35_Y	55_T	0.590	1.00
27_S	30_L	0.587	1.00
14_I	23_H	0.582	1.00
34_L	59_S	0.580	1.00
28_R	31_R	0.580	1.00
31_R	35_Y	0.577	1.00
26_L	66_G	0.566	1.00
41_N	44_G	0.566	1.00
38_L	41_N	0.557	1.00
27_S	55_T	0.546	1.00
9_Y	17_F	0.544	1.00
29_W	62_W	0.536	1.00
3_E	59_S	0.536	1.00
3_E	15_T	0.533	1.00
2_P	25_T	0.529	1.00
52_L	56_F	0.518	1.00
6_N	21_R	0.506	1.00
23_H	62_W	0.504	1.00
49_Y	56_F	0.500	1.00
30_L	58_L	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3wajA	1	0.9398	4.1	0.902	Contact Map
4hn9A	1	0.3253	2	0.917	Contact Map
1o7qA	1	0.3614	1.8	0.919	Contact Map
3pshA	1	0.3494	1.7	0.92	Contact Map
1qd5A	1	0.988	1.4	0.924	Contact Map
4mo9A	1	0.4217	1.3	0.925	Contact Map
3gzxA	3	0.4217	1.3	0.926	Contact Map
1qd6C	2	0.988	1.3	0.926	Contact Map
3iohA	2	0.241	1.2	0.926	Contact Map
1ijxA	2	0.3373	1	0.931	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0046 seconds.