DUF4186 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF4186 - Domain of unknown function (DUF4186)

PFAM:	PF13811	Sequences: DELFARLARSKFRSRFHLGGKDRAYLREKGLDTIREHARDFIAKRLAPAEPPNDGKQTPMRGHPVFVAQHATATCCRGCLEKWHGIPKGRELTEEEQDYVVAVIMRWIE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	109 (107)
Sequences:	2476 (1703)
Seq/√Len:	164.6
META:	0.87

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
90_R	96_E	4.406	1.00
43_A	97_Q	3.548	1.00
40_D	44_K	3.075	1.00
46_L	80_L	2.454	1.00
99_Y	103_V	2.403	1.00
24_A	28_E	2.331	1.00
80_L	100_V	2.331	1.00
38_A	65_V	2.252	1.00
81_E	88_K	2.227	1.00
84_H	99_Y	2.187	1.00
19_G	22_D	2.187	1.00
26_L	31_L	1.985	1.00
39_R	98_D	1.924	1.00
74_T	104_I	1.903	1.00
35_R	105_M	1.890	1.00
35_R	102_A	1.808	1.00
23_R	27_R	1.774	1.00
78_G	88_K	1.764	1.00
26_L	34_I	1.694	1.00
3_L	103_V	1.663	1.00
20_G	24_A	1.642	1.00
105_M	108_I	1.587	1.00
42_I	97_Q	1.580	1.00
36_E	40_D	1.543	1.00
3_L	6_R	1.465	1.00
22_D	62_G	1.448	1.00
33_T	36_E	1.422	1.00
25_Y	64_P	1.406	1.00
19_G	67_V	1.367	1.00
29_K	33_T	1.340	1.00
11_K	14_S	1.331	1.00
53_N	56_K	1.304	1.00
87_P	90_R	1.296	1.00
35_R	101_V	1.283	1.00
11_K	15_R	1.254	1.00
22_D	67_V	1.251	1.00
24_A	27_R	1.217	1.00
39_R	97_Q	1.216	1.00
45_R	69_Q	1.213	1.00
48_P	51_P	1.203	1.00
94_E	98_D	1.197	1.00
37_H	41_F	1.177	1.00
43_A	94_E	1.171	1.00
39_R	43_A	1.164	1.00
26_L	108_I	1.126	1.00
20_G	23_R	1.126	1.00
75_C	79_C	1.116	1.00
5_A	9_R	1.098	1.00
49_A	89_G	1.097	1.00
42_I	100_V	1.089	1.00
46_L	100_V	1.043	0.99
38_A	101_V	1.037	0.99
51_P	89_G	1.018	0.99
76_C	79_C	0.998	0.99
16_F	60_M	0.992	0.99
41_F	45_R	0.988	0.99
47_A	97_Q	0.986	0.99
36_E	39_R	0.974	0.99
93_T	96_E	0.962	0.99
33_T	37_H	0.961	0.99
19_G	62_G	0.950	0.99
51_P	54_D	0.944	0.99
63_H	66_F	0.931	0.99
80_L	86_I	0.923	0.98
5_A	8_A	0.913	0.98
74_T	100_V	0.890	0.98
100_V	104_I	0.885	0.98
44_K	52_P	0.878	0.98
60_M	67_V	0.860	0.98
21_K	24_A	0.855	0.97
35_R	39_R	0.824	0.97
6_R	9_R	0.823	0.97
81_E	87_P	0.822	0.97
26_L	35_R	0.808	0.96
102_A	105_M	0.808	0.96
15_R	19_G	0.788	0.96
73_A	83_W	0.785	0.96
7_L	10_S	0.776	0.96
23_R	26_L	0.774	0.95
101_V	105_M	0.770	0.95
50_E	89_G	0.765	0.95
2_E	6_R	0.753	0.95
52_P	56_K	0.749	0.95
94_E	97_Q	0.740	0.94
10_S	14_S	0.734	0.94
72_T	104_I	0.733	0.94
32_D	105_M	0.722	0.93
29_K	37_H	0.721	0.93
54_D	57_Q	0.717	0.93
81_E	89_G	0.716	0.93
42_I	101_V	0.705	0.93
19_G	23_R	0.704	0.93
30_G	33_T	0.693	0.92
43_A	47_A	0.691	0.92
92_L	100_V	0.691	0.92
97_Q	101_V	0.687	0.92
61_R	67_V	0.676	0.91
33_T	83_W	0.676	0.91
86_I	96_E	0.676	0.91
25_Y	41_F	0.675	0.91
95_E	98_D	0.670	0.91
8_A	14_S	0.663	0.90
90_R	93_T	0.662	0.90
12_F	16_F	0.659	0.90
45_R	66_F	0.652	0.89
4_F	106_R	0.652	0.89
2_E	8_A	0.647	0.89
2_E	5_A	0.646	0.89
76_C	83_W	0.643	0.89
4_F	8_A	0.639	0.88
55_G	58_T	0.627	0.88
29_K	60_M	0.624	0.87
104_I	107_W	0.624	0.87
13_R	79_C	0.623	0.87
69_Q	74_T	0.622	0.87
4_F	14_S	0.617	0.87
27_R	31_L	0.616	0.87
65_V	104_I	0.612	0.86
22_D	26_L	0.610	0.86
99_Y	106_R	0.609	0.86
103_V	106_R	0.593	0.84
75_C	83_W	0.585	0.84
102_A	106_R	0.581	0.83
99_Y	108_I	0.581	0.83
47_A	94_E	0.572	0.82
79_C	83_W	0.572	0.82
2_E	81_E	0.560	0.81
10_S	83_W	0.558	0.81
37_H	63_H	0.555	0.80
31_L	35_R	0.554	0.80
3_L	84_H	0.553	0.80
21_K	28_E	0.550	0.80
23_R	103_V	0.549	0.80
13_R	75_C	0.547	0.79
10_S	82_K	0.546	0.79
73_A	79_C	0.544	0.79
4_F	103_V	0.543	0.79
74_T	80_L	0.538	0.78
26_L	67_V	0.536	0.78
12_F	15_R	0.535	0.78
49_A	91_E	0.534	0.78
21_K	67_V	0.533	0.78
61_R	107_W	0.533	0.78
31_L	105_M	0.533	0.78
14_S	17_H	0.531	0.77
25_Y	60_M	0.528	0.77
45_R	61_R	0.526	0.77
51_P	91_E	0.525	0.77
20_G	27_R	0.524	0.77
25_Y	29_K	0.523	0.76
39_R	101_V	0.523	0.76
37_H	40_D	0.517	0.76
3_L	99_Y	0.516	0.75
42_I	47_A	0.513	0.75
53_N	60_M	0.513	0.75
90_R	94_E	0.512	0.75
4_F	10_S	0.510	0.75
66_F	69_Q	0.504	0.74
18_L	64_P	0.502	0.73
99_Y	102_A	0.500	0.73

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3m62A	1	0.9725	44.5	0.924	Contact Map
1vsy4	1	0.9266	40.6	0.925	Contact Map
2o35A	4	0.6697	21.4	0.935	Contact Map
3fybA	2	0.6881	19.1	0.937	Contact Map
4wz3B	1	0.9174	11.3	0.943	Contact Map
2c2lA	1	0.9174	10.1	0.944	Contact Map
1h8aC	1	0.2018	9.3	0.945	Contact Map
3beyA	6	0.7431	9.2	0.945	Contact Map
1w27A	4	0.7798	9.1	0.945	Contact Map
2yy9A	2	0.3945	9.1	0.945	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0056 seconds.