PCYCGC - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PCYCGC - Protein of unknown function with PCYCGC motif

PFAM:	PF13798	Sequences: VLLLLALLLAACGSKEASSAAEHEHAQHAAANGDLQETTASADVLPSFLDDKPEEVRLAYQAAAKHPDLLEWIPCYCGCGESAGHKSNLDCFIAEVKEDGSVVWDDHGTRCGVCLEIALESIKMKKEGKSLKEIRQAIDEKYKEGYAKPTPTPMP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	155 (151)
Sequences:	501 (397)
Seq/√Len:	32.3
META:	0.639

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
120_E	141_K	4.921	1.00
92_F	118_A	3.746	1.00
92_F	108_G	3.601	1.00
59_A	115_L	3.039	1.00
62_A	122_I	2.941	1.00
129_K	133_E	2.852	1.00
125_K	131_L	2.567	1.00
106_D	110_R	2.161	0.99
124_M	127_E	2.160	0.99
66_H	69_L	2.046	0.98
63_A	70_L	2.036	0.98
73_I	121_S	1.938	0.97
69_L	131_L	1.920	0.97
88_N	117_I	1.897	0.97
36_Q	94_A	1.877	0.97
62_A	119_L	1.800	0.96
25_H	28_H	1.794	0.96
3_L	6_A	1.715	0.94
67_P	96_V	1.696	0.94
69_L	125_K	1.670	0.93
32_N	35_L	1.654	0.93
124_M	137_A	1.647	0.93
123_K	127_E	1.637	0.93
9_L	13_G	1.581	0.91
45_L	135_R	1.573	0.91
88_N	109_T	1.571	0.91
59_A	119_L	1.563	0.91
56_V	115_L	1.525	0.90
115_L	119_L	1.470	0.88
90_D	110_R	1.439	0.87
75_C	85_H	1.425	0.86
38_T	97_K	1.371	0.84
74_P	135_R	1.368	0.84
73_I	131_L	1.346	0.83
23_H	26_A	1.345	0.83
63_A	89_L	1.335	0.82
8_L	11_A	1.317	0.82
85_H	91_C	1.310	0.81
108_G	115_L	1.306	0.81
35_L	110_R	1.287	0.80
106_D	109_T	1.260	0.79
119_L	122_I	1.243	0.78
140_E	143_K	1.239	0.77
96_V	102_V	1.234	0.77
59_A	122_I	1.229	0.77
86_K	90_D	1.228	0.77
8_L	22_E	1.227	0.77
37_E	49_L	1.223	0.76
10_A	21_A	1.221	0.76
26_A	29_A	1.201	0.75
77_C	114_C	1.173	0.73
79_C	114_C	1.173	0.73
87_S	94_A	1.173	0.73
49_L	104_W	1.172	0.73
70_L	121_S	1.164	0.73
89_L	96_V	1.160	0.73
122_I	126_K	1.158	0.72
32_N	83_A	1.151	0.72
110_R	113_V	1.143	0.71
39_T	48_F	1.142	0.71
64_A	104_W	1.137	0.71
50_D	57_R	1.133	0.71
75_C	79_C	1.131	0.71
75_C	114_C	1.131	0.71
45_L	49_L	1.119	0.70
135_R	138_I	1.111	0.69
23_H	31_A	1.100	0.68
77_C	91_C	1.074	0.67
91_C	114_C	1.074	0.67
79_C	91_C	1.074	0.67
39_T	49_L	1.070	0.66
61_Q	65_K	1.059	0.65
90_D	105_D	1.057	0.65
12_C	139_D	1.054	0.65
80_G	84_G	1.035	0.64
75_C	91_C	1.028	0.63
120_E	137_A	1.019	0.62
76_Y	129_K	1.017	0.62
71_E	89_L	1.017	0.62
68_D	138_I	1.017	0.62
150_T	153_P	1.008	0.62
58_L	61_Q	1.005	0.61
97_K	103_V	0.992	0.60
42_A	102_V	0.987	0.60
107_H	111_C	0.966	0.58
7_L	16_E	0.964	0.58
5_L	16_E	0.952	0.57
15_K	19_S	0.949	0.57
56_V	108_G	0.946	0.57
9_L	12_C	0.940	0.56
112_G	116_E	0.933	0.56
71_E	102_V	0.929	0.55
85_H	114_C	0.924	0.55
79_C	85_H	0.924	0.55
77_C	85_H	0.924	0.55
48_F	106_D	0.918	0.54
94_A	101_S	0.912	0.54
24_E	133_E	0.907	0.53
27_Q	30_A	0.901	0.53
95_E	100_G	0.893	0.52
128_G	139_D	0.891	0.52
69_L	115_L	0.872	0.51
18_S	23_H	0.865	0.50
70_L	105_D	0.865	0.50
122_I	131_L	0.849	0.49
39_T	46_P	0.848	0.49
72_W	89_L	0.847	0.49
67_P	89_L	0.842	0.48
83_A	106_D	0.840	0.48
106_D	113_V	0.840	0.48
15_K	140_E	0.835	0.48
79_C	111_C	0.833	0.47
77_C	111_C	0.833	0.47
111_C	114_C	0.833	0.47
13_G	40_A	0.831	0.47
11_A	116_E	0.823	0.47
34_D	39_T	0.823	0.47
8_L	16_E	0.823	0.47
87_S	90_D	0.821	0.46
71_E	87_S	0.818	0.46
15_K	23_H	0.816	0.46
6_A	17_A	0.810	0.45
135_R	152_T	0.810	0.45
19_S	31_A	0.798	0.44
74_P	90_D	0.780	0.43
11_A	153_P	0.780	0.43
97_K	101_S	0.779	0.43
46_P	107_H	0.778	0.43
75_C	111_C	0.778	0.43
70_L	88_N	0.774	0.43
146_Y	149_P	0.768	0.42
23_H	28_H	0.767	0.42
5_L	98_E	0.763	0.42
105_D	110_R	0.757	0.41
20_A	24_E	0.756	0.41
31_A	47_S	0.754	0.41
134_I	139_D	0.754	0.41
81_E	108_G	0.749	0.41
4_L	7_L	0.746	0.40
51_D	130_S	0.745	0.40
32_N	36_Q	0.741	0.40
76_Y	131_L	0.728	0.39
8_L	18_S	0.727	0.39
91_C	111_C	0.725	0.39
10_A	17_A	0.722	0.38
89_L	112_G	0.720	0.38
10_A	23_H	0.708	0.37
4_L	19_S	0.706	0.37
80_G	139_D	0.702	0.37
3_L	8_L	0.700	0.37
45_L	142_Y	0.696	0.36
105_D	117_I	0.690	0.36
9_L	16_E	0.687	0.36
72_W	95_E	0.687	0.36
72_W	124_M	0.684	0.35
37_E	93_I	0.675	0.35
81_E	92_F	0.674	0.35
48_F	104_W	0.670	0.34
63_A	103_V	0.664	0.34
33_G	147_A	0.662	0.34
32_N	110_R	0.657	0.33
17_A	24_E	0.656	0.33
41_S	110_R	0.654	0.33
37_E	48_F	0.652	0.33
65_K	81_E	0.649	0.33
31_A	34_D	0.649	0.33
62_A	65_K	0.644	0.33
39_T	104_W	0.642	0.32
18_S	136_Q	0.638	0.32
56_V	125_K	0.637	0.32
6_A	15_K	0.635	0.32
59_A	108_G	0.633	0.32
90_D	113_V	0.631	0.32
52_K	109_T	0.630	0.32
18_S	121_S	0.629	0.31
130_S	151_P	0.628	0.31
7_L	24_E	0.628	0.31
83_A	108_G	0.623	0.31
86_K	118_A	0.621	0.31
54_E	57_R	0.620	0.31
57_R	67_P	0.617	0.31
97_K	100_G	0.616	0.31
22_E	28_H	0.614	0.30
58_L	62_A	0.612	0.30
43_D	65_K	0.607	0.30
32_N	108_G	0.599	0.29
55_E	140_E	0.596	0.29
108_G	116_E	0.595	0.29
48_F	109_T	0.587	0.29
29_A	98_E	0.586	0.28
3_L	16_E	0.578	0.28
22_E	26_A	0.577	0.28
66_H	151_P	0.565	0.27
52_K	56_V	0.565	0.27
92_F	142_Y	0.560	0.27
96_V	100_G	0.558	0.27
33_G	82_S	0.556	0.27
66_H	132_K	0.554	0.26
85_H	111_C	0.554	0.26
36_Q	105_D	0.549	0.26
89_L	151_P	0.547	0.26
19_S	24_E	0.547	0.26
11_A	17_A	0.547	0.26
54_E	58_L	0.545	0.26
69_L	73_I	0.541	0.26
145_G	149_P	0.540	0.25
10_A	26_A	0.534	0.25
43_D	50_D	0.532	0.25
33_G	38_T	0.532	0.25
29_A	148_K	0.531	0.25
24_E	129_K	0.530	0.25
78_G	128_G	0.528	0.25
32_N	50_D	0.524	0.25
57_R	63_A	0.522	0.24
63_A	122_I	0.521	0.24
38_T	101_S	0.520	0.24
25_H	29_A	0.520	0.24
62_A	66_H	0.518	0.24
72_W	131_L	0.517	0.24
66_H	119_L	0.517	0.24
99_D	106_D	0.514	0.24
133_E	137_A	0.510	0.24
119_L	123_K	0.502	0.23
57_R	97_K	0.502	0.23
113_V	146_Y	0.502	0.23
70_L	118_A	0.500	0.23

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2kw0A	1	0.5226	73.4	0.923	Contact Map
2hl7A	1	0.5161	58.9	0.93	Contact Map
3bqpA	1	0.2839	55.3	0.931	Contact Map
1l9lA	1	0.271	49.5	0.933	Contact Map
1nklA	1	0.271	43.4	0.936	Contact Map
3zbiC	1	0.1806	30.1	0.941	Contact Map
2gtgA	1	0.2774	26.6	0.943	Contact Map
1of9A	1	0.2774	24.4	0.944	Contact Map
3s64A	2	0.3032	19	0.946	Contact Map
1n69A	2	0.2903	18.2	0.947	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.