Sensor - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Sensor - Putative sensor

PFAM:	PF13796	Sequences: YLLLGLPLGIAYFVVLVTGLSLGLGLLVLLVGLPLLALTLLAARGLAALERRRARALLGVRIPRPPPRPRPGGLWRRLRARLRDPATWRDLAYLLLKLPLGIVAFVLAVTLWAVGLALLTAPLWTLPEALLAAALGLLLLLAAPWLARGLARLHAALARALL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	162 (162)
Sequences:	9523 (7306)
Seq/√Len:	574.0
META:	0.757

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
120_T	124_W	2.937	1.00
15_V	42_A	2.769	1.00
48_A	64_R	2.689	1.00
79_R	83_R	2.647	1.00
66_P	90_D	2.616	1.00
76_R	79_R	2.528	1.00
14_V	18_T	2.382	1.00
10_I	14_V	2.311	1.00
19_G	39_T	2.285	1.00
17_V	21_S	2.217	1.00
55_R	61_R	2.164	1.00
102_I	106_V	2.139	1.00
54_A	158_A	2.121	1.00
50_E	53_R	2.049	1.00
7_P	10_I	2.005	1.00
99_P	102_I	1.980	1.00
23_G	35_L	1.899	1.00
126_L	129_A	1.829	1.00
73_G	76_R	1.796	1.00
13_F	17_V	1.706	1.00
85_P	89_R	1.695	1.00
8_L	12_Y	1.604	1.00
15_V	19_G	1.599	1.00
115_G	140_L	1.568	1.00
23_G	36_L	1.550	1.00
30_L	34_P	1.534	1.00
121_A	132_A	1.518	1.00
115_G	139_L	1.511	1.00
120_T	123_L	1.486	1.00
86_A	90_D	1.460	1.00
47_A	90_D	1.451	1.00
54_A	58_L	1.449	1.00
45_G	48_A	1.447	1.00
130_L	134_A	1.404	1.00
44_R	84_D	1.402	1.00
86_A	89_R	1.386	1.00
44_R	87_T	1.383	1.00
18_T	22_L	1.361	1.00
96_L	157_L	1.359	1.00
141_L	144_P	1.336	1.00
43_A	94_L	1.335	1.00
11_A	14_V	1.328	1.00
157_L	160_A	1.326	1.00
127_P	130_L	1.315	1.00
55_R	60_V	1.314	1.00
106_V	110_T	1.296	1.00
24_L	28_V	1.279	1.00
111_L	143_A	1.261	1.00
16_L	94_L	1.259	1.00
34_P	37_A	1.255	1.00
152_R	156_A	1.249	1.00
6_L	10_I	1.236	1.00
22_L	26_L	1.234	1.00
67_P	70_R	1.228	1.00
62_I	158_A	1.222	1.00
60_V	155_A	1.217	1.00
153_L	156_A	1.213	1.00
43_A	91_L	1.208	1.00
129_A	133_A	1.201	1.00
72_G	76_R	1.200	1.00
25_G	28_V	1.199	1.00
21_S	25_G	1.198	1.00
126_L	130_L	1.197	1.00
12_Y	46_L	1.191	1.00
60_V	159_R	1.175	1.00
115_G	143_A	1.170	1.00
44_R	90_D	1.168	1.00
149_G	153_L	1.163	1.00
7_P	11_A	1.163	1.00
99_P	103_V	1.163	1.00
108_A	112_W	1.162	1.00
40_L	87_T	1.148	1.00
156_A	160_A	1.138	1.00
11_A	15_V	1.126	1.00
23_G	39_T	1.119	1.00
104_A	150_L	1.110	1.00
22_L	25_G	1.105	1.00
112_W	147_A	1.101	1.00
84_D	87_T	1.089	1.00
114_V	117_A	1.085	1.00
53_R	97_K	1.077	1.00
46_L	94_L	1.076	1.00
145_W	148_R	1.072	1.00
53_R	56_A	1.065	1.00
95_L	99_P	1.061	1.00
72_G	80_A	1.059	1.00
98_L	102_I	1.056	1.00
68_R	71_P	1.056	1.00
67_P	71_P	1.054	1.00
148_R	152_R	1.052	1.00
144_P	148_R	1.050	1.00
51_R	62_I	1.048	1.00
38_L	41_L	1.029	1.00
23_G	27_L	1.009	1.00
137_L	141_L	1.007	1.00
125_T	128_E	0.998	1.00
41_L	45_G	0.997	1.00
155_A	159_R	0.987	1.00
109_V	113_A	0.981	1.00
49_L	52_R	0.967	1.00
100_L	157_L	0.967	1.00
110_T	114_V	0.966	1.00
10_I	18_T	0.965	1.00
26_L	29_L	0.965	1.00
105_F	109_V	0.951	1.00
27_L	33_L	0.945	1.00
5_G	53_R	0.934	1.00
122_P	133_A	0.933	1.00
76_R	80_A	0.923	1.00
100_L	104_A	0.916	1.00
1_Y	93_Y	0.912	1.00
48_A	52_R	0.903	1.00
14_V	22_L	0.902	1.00
31_V	34_P	0.894	1.00
40_L	43_A	0.885	1.00
1_Y	5_G	0.876	1.00
102_I	105_F	0.873	1.00
18_T	21_S	0.873	1.00
25_G	29_L	0.870	1.00
151_A	155_A	0.861	1.00
52_R	56_A	0.859	1.00
41_L	81_R	0.857	1.00
127_P	131_L	0.856	1.00
96_L	99_P	0.849	1.00
141_L	145_W	0.848	1.00
119_L	122_P	0.843	1.00
119_L	137_L	0.841	1.00
140_L	144_P	0.841	1.00
97_K	100_L	0.824	1.00
74_L	77_R	0.821	1.00
75_W	79_R	0.821	1.00
97_K	154_H	0.818	1.00
111_L	142_A	0.817	1.00
45_G	49_L	0.814	1.00
40_L	91_L	0.812	1.00
52_R	55_R	0.810	1.00
43_A	87_T	0.810	1.00
50_E	97_K	0.804	1.00
51_R	89_R	0.800	1.00
129_A	132_A	0.799	1.00
103_V	107_L	0.797	1.00
42_A	45_G	0.797	1.00
148_R	151_A	0.790	1.00
93_Y	97_K	0.784	1.00
108_A	147_A	0.782	1.00
66_P	86_A	0.782	1.00
122_P	136_G	0.781	1.00
149_G	152_R	0.781	1.00
134_A	138_L	0.769	1.00
32_G	35_L	0.768	1.00
36_L	40_L	0.762	1.00
156_A	159_R	0.758	1.00
9_G	97_K	0.751	1.00
40_L	82_L	0.744	1.00
87_T	90_D	0.742	1.00
4_L	7_P	0.734	1.00
69_P	80_A	0.734	1.00
118_L	121_A	0.728	1.00
103_V	106_V	0.727	1.00
136_G	140_L	0.727	1.00
16_L	91_L	0.722	1.00
38_L	42_A	0.720	1.00
139_L	142_A	0.716	1.00
130_L	133_A	0.709	1.00
66_P	84_D	0.707	1.00
102_I	110_T	0.706	1.00
117_A	121_A	0.704	1.00
157_L	161_L	0.697	1.00
51_R	90_D	0.695	1.00
65_P	86_A	0.692	1.00
93_Y	158_A	0.690	1.00
152_R	155_A	0.688	1.00
47_A	65_P	0.686	1.00
133_A	137_L	0.682	1.00
89_R	92_A	0.678	1.00
142_A	146_L	0.677	1.00
118_L	122_P	0.671	1.00
98_L	101_G	0.669	1.00
6_L	14_V	0.668	1.00
6_L	105_F	0.664	1.00
50_E	94_L	0.663	1.00
116_L	120_T	0.654	1.00
50_E	158_A	0.653	1.00
114_V	118_L	0.648	1.00
12_Y	94_L	0.643	1.00
16_L	43_A	0.640	1.00
112_W	143_A	0.639	1.00
151_A	154_H	0.638	1.00
53_R	154_H	0.634	1.00
128_E	132_A	0.627	1.00
26_L	30_L	0.619	1.00
115_G	118_L	0.616	1.00
44_R	81_R	0.612	1.00
144_P	154_H	0.612	1.00
42_A	46_L	0.610	1.00
87_T	91_L	0.605	1.00
1_Y	53_R	0.605	1.00
62_I	65_P	0.599	1.00
47_A	50_E	0.598	1.00
78_L	81_R	0.594	1.00
117_A	124_W	0.591	1.00
73_G	77_R	0.588	1.00
54_A	57_L	0.587	1.00
6_L	98_L	0.579	1.00
143_A	147_A	0.577	1.00
12_Y	16_L	0.571	1.00
5_G	154_H	0.571	1.00
142_A	145_W	0.569	0.99
40_L	90_D	0.569	0.99
118_L	132_A	0.566	0.99
55_R	62_I	0.562	0.99
125_T	129_A	0.558	0.99
1_Y	54_A	0.557	0.99
43_A	90_D	0.544	0.99
22_L	29_L	0.544	0.99
108_A	111_L	0.543	0.99
114_V	139_L	0.540	0.99
108_A	150_L	0.539	0.99
115_G	119_L	0.539	0.99
49_L	53_R	0.536	0.99
131_L	135_L	0.531	0.99
154_H	158_A	0.530	0.99
135_L	139_L	0.530	0.99
12_Y	19_G	0.529	0.99
37_A	41_L	0.528	0.99
106_V	109_V	0.528	0.99
100_L	154_H	0.524	0.99
75_W	78_L	0.522	0.99
74_L	78_L	0.521	0.99
9_G	101_G	0.520	0.99
80_A	83_R	0.520	0.99
150_L	153_L	0.518	0.99
50_E	154_H	0.517	0.99
13_F	16_L	0.516	0.99
21_S	27_L	0.513	0.99
115_G	141_L	0.513	0.99
145_W	149_G	0.511	0.99
22_L	35_L	0.508	0.99
153_L	157_L	0.507	0.99
126_L	133_A	0.506	0.99
10_I	98_L	0.504	0.99
13_F	98_L	0.503	0.99
44_R	77_R	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4hkrA	3	0.679	1.9	0.933	Contact Map
4wisA	2	0.8951	1.2	0.941	Contact Map
3giaA	1	0.3642	1.1	0.942	Contact Map
4jweC	1	0.0617	1.1	0.943	Contact Map
2m20A	2	0.3642	0.8	0.946	Contact Map
1a87A	1	0.3704	0.7	0.949	Contact Map
4p02B	1	0.3086	0.7	0.95	Contact Map
2kncB	1	0.4568	0.6	0.951	Contact Map
4c7rA	3	0.4691	0.6	0.951	Contact Map
1f2vA	2	0.4012	0.6	0.952	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0067 seconds.