HupE_UreJ_2 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

HupE_UreJ_2 - HupE / UreJ protein

PFAM:	PF13795	Sequences: YLRLGVEHILTGYDHLLFLLGLLLPYLVRRLRRLLKTVTAFTVAHSITLALAALGLVSLPSRLVEALIALSIVYVALENLRFRGRPGLTRRRRWLVAFAFGLIHGFGFAGALRELGLPGGALLLALLSFNVGVELGQLAVVAAVLPLLALLRRT	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	154 (151)
Sequences:	21499 (11406)
Seq/√Len:	928.2
META:	0.94

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
32_R	36_K	4.307	1.00
2_L	135_L	3.805	1.00
63_L	66_A	3.203	1.00
30_R	33_R	2.952	1.00
3_R	7_E	2.759	1.00
4_L	7_E	2.567	1.00
33_R	36_K	2.322	1.00
38_V	141_V	2.300	1.00
7_E	11_T	2.282	1.00
68_I	107_G	2.247	1.00
16_L	140_V	2.159	1.00
55_G	58_S	2.002	1.00
40_A	94_W	1.939	1.00
21_G	75_V	1.898	1.00
51_L	56_L	1.878	1.00
67_L	103_I	1.863	1.00
52_A	106_F	1.835	1.00
57_V	106_F	1.818	1.00
124_L	128_S	1.775	1.00
20_L	144_V	1.700	1.00
63_L	67_L	1.653	1.00
77_L	81_R	1.648	1.00
44_A	98_F	1.635	1.00
40_A	98_F	1.632	1.00
78_E	93_R	1.588	1.00
74_Y	78_E	1.559	1.00
55_G	113_R	1.549	1.00
62_R	66_A	1.545	1.00
61_S	110_G	1.537	1.00
35_L	138_L	1.510	1.00
92_R	95_L	1.447	1.00
21_G	76_A	1.441	1.00
2_L	128_S	1.374	1.00
6_V	135_L	1.364	1.00
122_L	125_A	1.362	1.00
95_L	99_A	1.349	1.00
50_A	54_L	1.348	1.00
37_T	97_A	1.321	1.00
143_A	146_P	1.310	1.00
11_T	111_A	1.306	1.00
131_V	135_L	1.291	1.00
50_A	53_A	1.287	1.00
99_A	103_I	1.275	1.00
6_V	139_A	1.257	1.00
7_E	10_L	1.244	1.00
81_R	85_R	1.240	1.00
6_V	10_L	1.237	1.00
144_V	148_L	1.210	1.00
40_A	97_A	1.208	1.00
60_P	63_L	1.190	1.00
51_L	57_V	1.173	1.00
48_T	102_L	1.170	1.00
53_A	112_L	1.151	1.00
46_S	130_N	1.136	1.00
146_P	150_L	1.134	1.00
54_L	122_L	1.128	1.00
31_L	35_L	1.122	1.00
66_A	70_L	1.122	1.00
59_L	63_L	1.097	1.00
85_R	88_L	1.094	1.00
2_L	6_V	1.094	1.00
45_H	134_E	1.092	1.00
22_L	97_A	1.082	1.00
29_R	33_R	1.082	1.00
36_K	94_W	1.080	1.00
34_L	38_V	1.062	1.00
8_H	15_H	1.060	1.00
58_S	113_R	1.058	1.00
20_L	140_V	1.052	1.00
9_I	133_V	1.050	1.00
61_S	66_A	1.048	1.00
130_N	137_Q	1.048	1.00
139_A	142_A	1.048	1.00
147_L	150_L	1.046	1.00
123_L	127_L	1.046	1.00
9_I	136_G	1.044	1.00
4_L	115_L	1.038	1.00
120_G	124_L	1.034	1.00
139_A	143_A	1.033	1.00
16_L	20_L	1.031	1.00
51_L	55_G	1.031	1.00
140_V	144_V	1.028	1.00
86_P	90_R	1.021	1.00
59_L	106_F	1.020	1.00
116_G	119_G	1.020	1.00
27_L	30_R	1.013	1.00
150_L	153_R	1.001	1.00
146_P	149_A	1.000	1.00
145_L	149_A	0.998	1.00
82_F	85_R	0.993	1.00
127_L	131_V	0.990	1.00
138_L	142_A	0.987	1.00
33_R	93_R	0.969	1.00
23_L	141_V	0.963	1.00
10_L	139_A	0.950	1.00
47_I	51_L	0.942	1.00
148_L	152_R	0.935	1.00
128_S	131_V	0.932	1.00
15_H	104_H	0.932	1.00
87_G	90_R	0.923	1.00
149_A	152_R	0.913	1.00
142_A	146_P	0.900	1.00
19_L	38_V	0.898	1.00
111_A	115_L	0.896	1.00
149_A	153_R	0.883	1.00
81_R	84_G	0.876	1.00
107_G	111_A	0.869	1.00
101_G	105_G	0.866	1.00
71_S	75_V	0.864	1.00
23_L	144_V	0.864	1.00
73_V	77_L	0.863	1.00
86_P	91_R	0.846	1.00
119_G	122_L	0.846	1.00
6_V	11_T	0.837	1.00
121_A	125_A	0.829	1.00
13_Y	17_L	0.826	1.00
133_V	136_G	0.825	1.00
79_N	93_R	0.824	1.00
121_A	124_L	0.823	1.00
1_Y	4_L	0.815	1.00
86_P	89_T	0.813	1.00
53_A	123_L	0.807	1.00
145_L	148_L	0.804	1.00
118_P	125_A	0.800	1.00
130_N	134_E	0.797	1.00
46_S	49_L	0.796	1.00
89_T	92_R	0.794	1.00
124_L	127_L	0.794	1.00
78_E	92_R	0.791	1.00
70_L	73_V	0.786	1.00
118_P	121_A	0.773	1.00
58_S	62_R	0.767	1.00
148_L	151_L	0.762	1.00
93_R	96_V	0.756	1.00
6_V	9_I	0.747	1.00
4_L	11_T	0.747	1.00
140_V	146_P	0.746	1.00
39_T	42_T	0.741	1.00
28_V	32_R	0.736	1.00
32_R	35_L	0.730	1.00
142_A	149_A	0.729	1.00
59_L	64_V	0.722	1.00
75_V	78_E	0.719	1.00
67_L	70_L	0.718	1.00
50_A	126_L	0.715	1.00
100_F	109_A	0.713	1.00
18_F	100_F	0.713	1.00
112_L	116_G	0.712	1.00
94_W	133_V	0.712	1.00
119_G	125_A	0.708	1.00
91_R	95_L	0.702	1.00
75_V	79_N	0.696	1.00
116_G	125_A	0.691	1.00
44_A	102_L	0.681	1.00
19_L	37_T	0.675	1.00
1_Y	116_G	0.673	1.00
60_P	66_A	0.667	1.00
56_L	59_L	0.663	1.00
143_A	147_L	0.663	1.00
71_S	100_F	0.663	1.00
39_T	137_Q	0.662	1.00
36_K	40_A	0.661	1.00
68_I	71_S	0.656	1.00
15_H	45_H	0.654	1.00
88_L	92_R	0.654	1.00
147_L	151_L	0.652	1.00
23_L	37_T	0.649	1.00
3_R	6_V	0.647	1.00
42_T	137_Q	0.644	1.00
134_E	137_Q	0.644	1.00
11_T	16_L	0.641	1.00
28_V	31_L	0.637	1.00
8_H	45_H	0.618	1.00
23_L	148_L	0.617	1.00
77_L	82_F	0.613	1.00
135_L	139_A	0.611	1.00
37_T	93_R	0.608	1.00
37_T	79_N	0.605	1.00
65_E	68_I	0.603	1.00
42_T	134_E	0.597	1.00
54_L	123_L	0.596	1.00
53_A	122_L	0.595	1.00
110_G	114_E	0.594	1.00
35_L	39_T	0.593	1.00
33_R	37_T	0.591	1.00
94_W	97_A	0.588	1.00
107_G	110_G	0.587	1.00
111_A	114_E	0.580	1.00
71_S	103_I	0.578	1.00
74_Y	89_T	0.577	1.00
24_L	79_N	0.570	1.00
51_L	59_L	0.568	1.00
115_L	125_A	0.568	1.00
21_G	78_E	0.562	1.00
19_L	22_L	0.562	1.00
52_A	109_A	0.557	1.00
98_F	102_L	0.549	1.00
117_L	120_G	0.548	1.00
51_L	106_F	0.548	1.00
8_H	39_T	0.548	1.00
8_H	68_I	0.547	1.00
43_V	46_S	0.547	1.00
41_F	45_H	0.546	1.00
46_S	108_F	0.542	1.00
43_V	98_F	0.541	1.00
42_T	65_E	0.537	1.00
52_A	113_R	0.537	1.00
34_L	141_V	0.536	1.00
35_L	42_T	0.531	1.00
21_G	24_L	0.530	1.00
46_S	50_A	0.530	1.00
15_H	68_I	0.529	1.00
24_L	27_L	0.528	1.00
82_F	86_P	0.527	1.00
81_R	87_G	0.521	1.00
81_R	86_P	0.520	1.00
23_L	34_L	0.519	1.00
146_P	151_L	0.517	1.00
136_G	139_A	0.515	1.00
53_A	117_L	0.513	1.00
10_L	16_L	0.511	1.00
88_L	91_R	0.508	1.00
117_L	125_A	0.508	1.00
145_L	150_L	0.506	1.00
120_G	123_L	0.506	1.00
83_R	87_G	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4k0jA	3	0.8896	4.9	0.928	Contact Map
2kluA	1	0.2403	4.4	0.93	Contact Map
2m20A	2	0.1948	4.3	0.931	Contact Map
2l2tA	2	0.2403	3.8	0.932	Contact Map
3ne5A	3	0.974	3	0.936	Contact Map
1iijA	1	0.2273	2.9	0.936	Contact Map
2l9uA	2	0.2143	2.6	0.938	Contact Map
1tviA	1	0.3377	2.2	0.94	Contact Map
3w9iA	3	0.974	1.7	0.944	Contact Map
4mt1A	3	0.9545	1.7	0.944	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.