HXXEE - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

HXXEE - Protein of unknown function with HXXEE motif

PFAM:	PF13787	Sequences: WLLPLAYALHQFEEYIGFPAWLRRNRPLPFPNFALAVAEEFLLAALLVVNALLVWLAYLAALRGPRAPWLGLALAALLLVNGLFHILAAIVLRGYSPGLVTAVLLFLPLGIYA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	113 (110)
Sequences:	6825 (5582)
Seq/√Len:	532.2
META:	0.906

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
41_F	45_A	3.261	1.00
89_A	99_L	3.256	1.00
77_L	81_N	2.264	1.00
103_V	108_P	2.181	1.00
46_L	50_N	2.155	1.00
89_A	96_S	2.018	1.00
6_A	105_L	2.012	1.00
78_L	81_N	1.990	1.00
13_E	95_Y	1.958	1.00
42_L	46_L	1.873	1.00
42_L	45_A	1.866	1.00
17_G	20_A	1.840	1.00
12_F	16_I	1.838	1.00
9_L	101_T	1.691	1.00
36_A	40_E	1.655	1.00
35_L	40_E	1.613	1.00
41_F	44_A	1.583	1.00
6_A	109_L	1.567	1.00
23_R	26_R	1.547	1.00
19_P	23_R	1.523	1.00
89_A	94_G	1.521	1.00
7_Y	11_Q	1.509	1.00
37_V	40_E	1.494	1.00
77_L	80_V	1.463	1.00
42_L	50_N	1.437	1.00
87_L	91_V	1.429	1.00
47_L	50_N	1.390	1.00
49_V	53_L	1.388	1.00
88_A	96_S	1.374	1.00
21_W	25_N	1.331	1.00
48_V	52_L	1.326	1.00
84_F	88_A	1.321	1.00
20_A	24_R	1.306	1.00
50_N	54_V	1.301	1.00
35_L	38_A	1.289	1.00
82_G	107_L	1.269	1.00
72_L	75_A	1.262	1.00
22_L	25_N	1.255	1.00
46_L	49_V	1.249	1.00
18_F	23_R	1.249	1.00
95_Y	100_V	1.248	1.00
45_A	49_V	1.217	1.00
18_F	21_W	1.201	1.00
53_L	56_L	1.188	1.00
4_P	8_A	1.182	1.00
62_L	65_P	1.178	1.00
99_L	103_V	1.173	1.00
71_G	74_L	1.133	1.00
11_Q	15_Y	1.109	1.00
49_V	52_L	1.091	1.00
79_L	110_G	1.089	1.00
44_A	47_L	1.069	1.00
18_F	22_L	1.064	1.00
47_L	51_A	1.058	1.00
44_A	48_V	1.050	1.00
86_I	90_I	1.047	1.00
20_A	23_R	1.045	1.00
86_I	103_V	1.044	1.00
106_F	109_L	1.034	1.00
21_W	24_R	1.030	1.00
3_L	75_A	1.025	1.00
40_E	44_A	1.025	1.00
19_P	25_N	1.024	1.00
61_A	64_G	1.013	1.00
36_A	39_E	1.009	1.00
41_F	50_N	1.009	1.00
43_L	47_L	1.007	1.00
88_A	92_L	0.987	1.00
45_A	52_L	0.974	1.00
61_A	65_P	0.972	1.00
42_L	53_L	0.959	1.00
48_V	51_A	0.957	1.00
60_A	64_G	0.952	1.00
22_L	28_L	0.937	1.00
59_L	62_L	0.922	1.00
52_L	55_W	0.911	1.00
21_W	97_P	0.908	1.00
82_G	103_V	0.905	1.00
11_Q	102_A	0.889	1.00
48_V	55_W	0.874	1.00
17_G	21_W	0.874	1.00
45_A	48_V	0.874	1.00
101_T	106_F	0.870	1.00
60_A	63_R	0.868	1.00
51_A	54_V	0.863	1.00
19_P	22_L	0.852	1.00
52_L	56_L	0.850	1.00
22_L	27_P	0.844	1.00
47_L	54_V	0.841	1.00
73_A	77_L	0.831	1.00
63_R	66_R	0.824	1.00
58_Y	61_A	0.821	1.00
33_F	37_V	0.819	1.00
25_N	28_L	0.811	1.00
38_A	41_F	0.800	1.00
35_L	39_E	0.791	1.00
71_G	75_A	0.790	1.00
46_L	51_A	0.774	1.00
51_A	55_W	0.763	1.00
25_N	29_P	0.760	1.00
43_L	46_L	0.757	1.00
22_L	26_R	0.757	1.00
42_L	52_L	0.754	1.00
45_A	51_A	0.754	1.00
88_A	91_V	0.738	1.00
45_A	53_L	0.736	1.00
63_R	71_G	0.734	1.00
8_A	12_F	0.728	1.00
3_L	6_A	0.727	1.00
23_R	28_L	0.702	1.00
59_L	63_R	0.701	1.00
84_F	96_S	0.701	1.00
96_S	99_L	0.695	1.00
64_G	67_A	0.692	1.00
41_F	49_V	0.691	1.00
89_A	92_L	0.677	1.00
11_Q	106_F	0.670	1.00
19_P	26_R	0.667	1.00
47_L	52_L	0.653	1.00
70_L	74_L	0.645	1.00
98_G	102_A	0.644	1.00
67_A	72_L	0.644	1.00
3_L	109_L	0.641	1.00
46_L	53_L	0.637	1.00
83_L	87_L	0.637	1.00
50_N	53_L	0.628	1.00
95_Y	99_L	0.627	1.00
62_L	67_A	0.623	1.00
21_W	26_R	0.623	1.00
41_F	46_L	0.617	1.00
46_L	56_L	0.615	1.00
23_R	27_P	0.610	1.00
19_P	27_P	0.609	1.00
40_E	45_A	0.602	1.00
12_F	15_Y	0.599	1.00
18_F	26_R	0.595	1.00
75_A	110_G	0.595	1.00
41_F	51_A	0.594	1.00
105_L	108_P	0.592	1.00
58_Y	62_L	0.592	1.00
5_L	8_A	0.591	0.99
11_Q	84_F	0.588	0.99
46_L	57_A	0.584	0.99
86_I	102_A	0.580	0.99
69_W	73_A	0.578	0.99
24_R	27_P	0.569	0.99
75_A	81_N	0.565	0.99
59_L	64_G	0.563	0.99
39_E	42_L	0.562	0.99
66_R	70_L	0.550	0.99
42_L	49_V	0.549	0.99
68_P	71_G	0.547	0.99
33_F	36_A	0.545	0.99
17_G	22_L	0.544	0.99
64_G	69_W	0.542	0.99
76_A	80_V	0.540	0.99
60_A	66_R	0.531	0.99
8_A	11_Q	0.528	0.99
65_P	68_P	0.519	0.99
13_E	101_T	0.516	0.99
11_Q	96_S	0.513	0.99
41_F	48_V	0.505	0.98
43_L	50_N	0.502	0.98
39_E	45_A	0.500	0.98
40_E	43_L	0.500	0.98

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1v54M	1	0.1593	3.2	0.904	Contact Map
1qp2A	1	0.2124	1	0.927	Contact Map
2ksfA	1	0.6018	1	0.927	Contact Map
3wmmA	3	0.3097	0.5	0.941	Contact Map
3iszA	2	0.3274	0.5	0.943	Contact Map
2i68A	2	0.4602	0.5	0.943	Contact Map
2jr1A	1	0.2478	0.5	0.943	Contact Map
3h3gB	1	0.1062	0.5	0.944	Contact Map
2qyvA	2	0.3363	0.4	0.947	Contact Map
1jqgA	1	0.2832	0.4	0.947	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0053 seconds.