DUF4167 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF4167 - Domain of unknown function (DUF4167)

PFAM:	PF13763	Sequences: RGRNRNNNRNRNRNRNRSFDSNGPDVKIRGNAQQIYEKYLQLARDAQSSGDRVLAENYLQHAEHYFRILNAAQEQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	75 (71)
Sequences:	5331 (2471)
Seq/√Len:	293.3
META:	0.959

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
57_N	61_H	2.942	1.00
43_A	59_L	2.867	1.00
66_F	70_N	2.426	1.00
36_Y	66_F	2.228	1.00
47_Q	55_A	2.193	1.00
54_L	58_Y	2.090	1.00
47_Q	59_L	2.065	1.00
36_Y	40_L	1.938	1.00
36_Y	69_L	1.927	1.00
44_R	48_S	1.915	1.00
9_R	12_N	1.857	1.00
10_N	13_R	1.494	1.00
5_R	8_N	1.478	1.00
20_D	27_K	1.466	1.00
54_L	57_N	1.431	1.00
40_L	59_L	1.419	1.00
4_N	7_N	1.352	1.00
26_V	29_R	1.334	1.00
19_F	23_G	1.299	1.00
6_N	9_R	1.253	1.00
66_F	71_A	1.250	1.00
28_I	35_I	1.239	1.00
21_S	24_P	1.233	1.00
7_N	10_N	1.208	1.00
6_N	10_N	1.155	1.00
8_N	12_N	1.152	1.00
5_R	10_N	1.142	1.00
33_Q	69_L	1.121	1.00
55_A	59_L	1.114	1.00
42_L	58_Y	1.100	1.00
46_A	51_D	1.098	1.00
9_R	13_R	1.096	1.00
17_R	21_S	1.093	1.00
12_N	15_R	1.089	1.00
32_A	68_I	1.067	1.00
39_Y	42_L	1.051	1.00
41_Q	45_D	1.041	1.00
70_N	73_Q	1.034	1.00
37_E	41_Q	1.033	1.00
7_N	11_R	1.025	1.00
5_R	9_R	1.022	1.00
26_V	30_G	1.008	1.00
45_D	48_S	1.006	1.00
25_D	28_I	0.999	1.00
33_Q	36_Y	0.995	1.00
17_R	22_N	0.942	1.00
44_R	66_F	0.934	1.00
19_F	24_P	0.924	1.00
68_I	72_A	0.919	1.00
35_I	40_L	0.916	1.00
18_S	24_P	0.903	1.00
69_L	73_Q	0.872	1.00
66_F	69_L	0.867	1.00
28_I	34_Q	0.865	1.00
51_D	59_L	0.851	1.00
4_N	11_R	0.834	1.00
24_P	30_G	0.825	1.00
63_E	66_F	0.807	1.00
18_S	21_S	0.795	0.99
23_G	28_I	0.778	0.99
19_F	35_I	0.767	0.99
32_A	35_I	0.765	0.99
20_D	23_G	0.759	0.99
8_N	11_R	0.753	0.99
27_K	30_G	0.731	0.99
34_Q	37_E	0.721	0.99
33_Q	72_A	0.720	0.99
40_L	66_F	0.709	0.99
23_G	29_R	0.706	0.99
23_G	26_V	0.703	0.99
20_D	29_R	0.691	0.99
24_P	29_R	0.686	0.98
54_L	72_A	0.682	0.98
33_Q	37_E	0.679	0.98
44_R	52_R	0.677	0.98
37_E	40_L	0.676	0.98
69_L	72_A	0.670	0.98
17_R	23_G	0.668	0.98
52_R	59_L	0.657	0.98
32_A	37_E	0.654	0.98
20_D	24_P	0.645	0.98
18_S	22_N	0.639	0.98
51_D	54_L	0.637	0.97
48_S	54_L	0.635	0.97
17_R	20_D	0.633	0.97
45_D	52_R	0.620	0.97
64_H	67_R	0.599	0.96
44_R	49_S	0.586	0.96
8_N	13_R	0.572	0.95
7_N	12_N	0.553	0.94
30_G	68_I	0.553	0.94
22_N	25_D	0.550	0.94
63_E	67_R	0.546	0.94
17_R	24_P	0.542	0.94
52_R	55_A	0.542	0.94
25_D	29_R	0.534	0.93
38_K	46_A	0.534	0.93
41_Q	44_R	0.533	0.93
3_R	13_R	0.526	0.93
34_Q	62_A	0.521	0.92
31_N	34_Q	0.515	0.92
21_S	29_R	0.514	0.92
39_Y	65_Y	0.510	0.92
35_I	38_K	0.507	0.91
40_L	44_R	0.506	0.91
41_Q	70_N	0.500	0.91

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2uuzA	2	0.28	10.5	0.894	Contact Map
3mkqA	2	0.96	7.8	0.9	Contact Map
2jpuA	1	0.6133	7.1	0.902	Contact Map
5a1uD	1	1	4.7	0.91	Contact Map
5a1uC	1	0.9867	4.2	0.912	Contact Map
4jhrA	2	0.3333	3.5	0.915	Contact Map
2oh3A	2	0.76	3.5	0.915	Contact Map
3s6nM	1	0.2	3.2	0.916	Contact Map
2lniA	1	0.7333	2.7	0.92	Contact Map
2oo2A	2	0.6533	2.6	0.92	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0046 seconds.