WxL - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

WxL - WxL domain surface cell wall-binding

PFAM:	PF13731	Sequences: AEVTTATSNGTVTFTPGTDPTDPVDPTDPDPTDPPPPGTTGPLSIDYVSSFDFGTQKISSKDQTYYAKAQLLNKKGTDGGTKERPNYVQVTDNRGTNAGWTLTVKQSQFKTTGGKELTGAELTLKNGTVVSNSGNTAPPPTASTVTLTLDPGGAAQTVMTAAAGQGAGTWVYRFGDDETATNDSVTLTVPGGTAKAAGTYTTTLTWTLSDTP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	212 (203)
Sequences:	1247 (1087)
Seq/√Len:	76.3
META:	0.211

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
104_V	204_L	7.163	1.00
46_D	91_T	4.218	1.00
15_T	55_T	3.296	1.00
106_Q	202_T	3.288	1.00
126_N	184_S	3.212	1.00
109_F	202_T	2.998	1.00
51_F	124_L	2.944	1.00
88_V	102_L	2.899	1.00
103_T	155_A	2.898	1.00
46_D	89_Q	2.759	1.00
107_S	202_T	2.628	1.00
159_M	172_Y	2.572	1.00
108_Q	116_E	2.476	1.00
125_K	186_T	2.388	1.00
121_E	188_T	2.318	1.00
51_F	185_V	2.295	1.00
17_G	93_N	2.291	1.00
62_D	188_T	2.230	1.00
145_V	149_L	2.166	1.00
99_G	166_G	2.104	1.00
13_T	55_T	2.082	1.00
102_L	208_L	2.077	1.00
107_S	205_T	2.039	1.00
94_R	210_D	2.013	1.00
15_T	57_K	1.996	1.00
64_T	188_T	1.974	1.00
103_T	209_S	1.948	1.00
11_T	52_D	1.940	1.00
56_Q	65_Y	1.937	1.00
107_S	203_T	1.916	1.00
97_N	167_A	1.911	1.00
45_I	102_L	1.883	1.00
65_Y	189_V	1.870	1.00
43_L	94_R	1.802	1.00
129_V	159_M	1.802	1.00
59_S	63_Q	1.801	1.00
191_G	195_K	1.768	1.00
47_Y	70_Q	1.754	1.00
64_T	186_T	1.687	1.00
66_Y	186_T	1.683	1.00
124_L	185_V	1.666	1.00
102_L	159_M	1.621	1.00
99_G	161_A	1.603	1.00
130_V	173_R	1.599	1.00
105_K	155_A	1.574	0.99
162_A	165_Q	1.545	0.99
44_S	91_T	1.508	0.99
161_A	166_G	1.505	0.99
87_Y	171_V	1.495	0.99
46_D	169_T	1.480	0.99
62_D	191_G	1.458	0.99
113_G	198_G	1.451	0.99
95_G	166_G	1.390	0.99
47_Y	87_Y	1.390	0.99
124_L	145_V	1.389	0.99
166_G	170_W	1.380	0.99
90_V	100_W	1.365	0.98
7_T	107_S	1.348	0.98
111_T	198_G	1.323	0.98
66_Y	183_D	1.265	0.97
149_L	152_G	1.259	0.97
52_D	68_K	1.243	0.97
137_A	140_P	1.237	0.97
18_T	57_K	1.224	0.97
122_L	204_L	1.220	0.97
7_T	203_T	1.210	0.97
53_F	117_L	1.208	0.97
127_G	174_F	1.207	0.97
128_T	173_R	1.204	0.97
98_A	210_D	1.191	0.96
157_T	160_T	1.176	0.96
177_D	180_A	1.164	0.96
60_S	194_A	1.154	0.96
17_G	57_K	1.144	0.95
65_Y	191_G	1.140	0.95
21_T	28_D	1.131	0.95
101_T	160_T	1.115	0.95
118_T	193_T	1.100	0.94
41_G	89_Q	1.061	0.93
175_G	184_S	1.045	0.93
131_S	170_W	1.045	0.93
119_G	190_P	1.040	0.92
132_N	135_N	1.033	0.92
91_T	169_T	1.024	0.92
122_L	187_L	1.022	0.92
117_L	189_V	1.005	0.91
51_F	208_L	0.992	0.90
24_V	171_V	0.986	0.90
88_V	159_M	0.982	0.90
69_A	182_N	0.968	0.89
155_A	209_S	0.967	0.89
100_W	170_W	0.964	0.89
95_G	98_A	0.958	0.89
20_P	23_P	0.956	0.89
106_Q	151_P	0.950	0.88
37_P	44_S	0.942	0.88
197_A	200_Y	0.940	0.88
49_S	70_Q	0.939	0.88
105_K	205_T	0.938	0.88
94_R	99_G	0.935	0.88
86_N	184_S	0.933	0.87
142_A	145_V	0.933	0.87
45_I	49_S	0.930	0.87
123_T	186_T	0.924	0.87
130_V	171_V	0.919	0.87
4_T	7_T	0.907	0.86
144_T	147_L	0.901	0.86
26_P	29_P	0.891	0.85
57_K	63_Q	0.880	0.84
25_D	84_R	0.878	0.84
10_G	109_F	0.872	0.84
104_V	202_T	0.866	0.83
170_W	173_R	0.858	0.83
123_T	188_T	0.849	0.82
161_A	164_G	0.839	0.81
7_T	13_T	0.838	0.81
35_P	50_S	0.827	0.80
78_D	81_T	0.824	0.80
17_G	20_P	0.823	0.80
103_T	157_T	0.823	0.80
95_G	200_Y	0.818	0.80
120_A	190_P	0.813	0.79
101_T	157_T	0.813	0.79
127_G	172_Y	0.811	0.79
45_I	208_L	0.802	0.78
84_R	170_W	0.801	0.78
95_G	161_A	0.796	0.78
95_G	99_G	0.794	0.78
25_D	29_P	0.793	0.77
121_E	146_T	0.788	0.77
6_A	48_V	0.787	0.77
6_A	45_I	0.786	0.77
7_T	10_G	0.786	0.77
47_Y	106_Q	0.776	0.76
78_D	82_K	0.769	0.75
176_D	180_A	0.768	0.75
43_L	91_T	0.767	0.75
25_D	35_P	0.764	0.75
40_T	44_S	0.759	0.74
105_K	152_G	0.756	0.74
110_K	113_G	0.754	0.74
47_Y	89_Q	0.754	0.74
108_Q	152_G	0.754	0.74
35_P	38_G	0.754	0.74
51_F	106_Q	0.751	0.74
58_I	62_D	0.749	0.73
52_D	122_L	0.749	0.73
19_D	22_D	0.747	0.73
131_S	137_A	0.744	0.73
70_Q	87_Y	0.744	0.73
89_Q	169_T	0.741	0.73
9_N	201_T	0.741	0.73
150_D	153_G	0.741	0.73
170_W	194_A	0.740	0.72
115_K	196_A	0.736	0.72
25_D	28_D	0.735	0.72
76_G	79_G	0.734	0.72
44_S	89_Q	0.734	0.72
97_N	201_T	0.733	0.72
83_E	182_N	0.732	0.72
8_S	49_S	0.732	0.72
97_N	196_A	0.732	0.72
120_A	193_T	0.731	0.72
152_G	156_Q	0.730	0.71
24_V	28_D	0.730	0.71
185_V	190_P	0.723	0.71
106_Q	204_L	0.722	0.71
100_W	208_L	0.719	0.70
151_P	154_A	0.718	0.70
99_G	168_G	0.716	0.70
100_W	124_L	0.710	0.69
18_T	178_E	0.706	0.69
206_W	212_P	0.705	0.69
65_Y	185_V	0.704	0.69
76_G	81_T	0.703	0.69
44_S	93_N	0.703	0.69
177_D	181_T	0.701	0.68
157_T	209_S	0.700	0.68
58_I	65_Y	0.696	0.68
86_N	126_N	0.696	0.68
34_P	153_G	0.696	0.68
93_N	195_K	0.696	0.68
6_A	39_T	0.693	0.67
168_G	190_P	0.693	0.67
27_T	85_P	0.692	0.67
167_A	198_G	0.690	0.67
77_T	80_G	0.686	0.67
109_F	172_Y	0.685	0.67
39_T	195_K	0.673	0.65
145_V	157_T	0.672	0.65
108_Q	120_A	0.668	0.65
23_P	29_P	0.668	0.65
98_A	164_G	0.666	0.64
14_F	201_T	0.663	0.64
109_F	203_T	0.661	0.64
60_S	134_G	0.659	0.64
131_S	166_G	0.657	0.63
37_P	89_Q	0.657	0.63
10_G	202_T	0.654	0.63
95_G	167_A	0.653	0.63
32_T	35_P	0.651	0.63
13_T	199_T	0.651	0.63
194_A	197_A	0.649	0.62
193_T	198_G	0.648	0.62
9_N	203_T	0.646	0.62
16_P	42_P	0.643	0.62
19_D	185_V	0.642	0.62
125_K	184_S	0.638	0.61
59_S	191_G	0.638	0.61
22_D	26_P	0.637	0.61
53_F	206_W	0.631	0.60
20_P	31_P	0.629	0.60
11_T	15_T	0.628	0.60
77_T	81_T	0.626	0.60
46_D	117_L	0.623	0.59
86_N	185_V	0.620	0.59
166_G	200_Y	0.617	0.59
67_A	70_Q	0.616	0.58
45_I	48_V	0.615	0.58
105_K	154_A	0.609	0.58
38_G	50_S	0.609	0.58
41_G	46_D	0.606	0.57
118_T	155_A	0.604	0.57
52_D	55_T	0.601	0.57
180_A	183_D	0.597	0.56
150_D	154_A	0.594	0.56
43_L	46_D	0.593	0.56
7_T	62_D	0.589	0.55
45_I	88_V	0.586	0.55
164_G	167_A	0.585	0.55
147_L	150_D	0.584	0.54
133_S	139_P	0.583	0.54
42_P	95_G	0.582	0.54
115_K	118_T	0.580	0.54
58_I	195_K	0.576	0.53
77_T	84_R	0.574	0.53
76_G	82_K	0.572	0.53
84_R	182_N	0.572	0.53
23_P	38_G	0.571	0.53
100_W	161_A	0.571	0.53
64_T	110_K	0.570	0.53
95_G	168_G	0.569	0.53
17_G	95_G	0.566	0.52
49_S	102_L	0.566	0.52
24_V	29_P	0.565	0.52
86_N	109_F	0.564	0.52
57_K	132_N	0.563	0.52
90_V	178_E	0.562	0.52
105_K	207_T	0.562	0.52
133_S	138_P	0.561	0.52
21_T	32_T	0.561	0.52
93_N	200_Y	0.561	0.52
149_L	189_V	0.560	0.51
191_G	194_A	0.555	0.51
189_V	195_K	0.554	0.51
146_T	149_L	0.553	0.51
87_Y	172_Y	0.553	0.51
13_T	201_T	0.553	0.51
123_T	144_T	0.552	0.50
106_Q	205_T	0.552	0.50
29_P	34_P	0.551	0.50
19_D	113_G	0.550	0.50
90_V	208_L	0.549	0.50
42_P	191_G	0.547	0.50
121_E	186_T	0.545	0.50
174_F	184_S	0.545	0.50
8_S	63_Q	0.544	0.49
15_T	19_D	0.544	0.49
30_D	36_P	0.543	0.49
33_D	192_G	0.540	0.49
4_T	210_D	0.538	0.49
174_F	206_W	0.535	0.48
142_A	146_T	0.534	0.48
69_A	127_G	0.532	0.48
195_K	200_Y	0.532	0.48
12_V	182_N	0.531	0.48
196_A	202_T	0.530	0.48
60_S	97_N	0.530	0.48
10_G	116_E	0.530	0.48
13_T	18_T	0.529	0.47
99_G	119_G	0.528	0.47
25_D	34_P	0.528	0.47
109_F	122_L	0.528	0.47
18_T	21_T	0.525	0.47
143_S	146_T	0.524	0.47
42_P	93_N	0.524	0.47
25_D	32_T	0.524	0.47
150_D	205_T	0.523	0.47
22_D	30_D	0.523	0.47
20_P	27_T	0.521	0.46
4_T	11_T	0.519	0.46
7_T	113_G	0.516	0.46
13_T	211_T	0.512	0.45
20_P	37_P	0.511	0.45
77_T	82_K	0.510	0.45
207_T	210_D	0.508	0.45
161_A	170_W	0.505	0.44
9_N	50_S	0.505	0.44
145_V	154_A	0.503	0.44
102_L	197_A	0.502	0.44
119_G	166_G	0.502	0.44
12_V	22_D	0.502	0.44
33_D	36_P	0.500	0.44
159_M	170_W	0.500	0.44

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3f85A	1	0.9009	3.2	0.947	Contact Map
2ns0A	1	0.1792	2.9	0.948	Contact Map
3f83A	1	0.8679	2.4	0.95	Contact Map
3onrA	5	0.3066	1.5	0.955	Contact Map
3e21A	1	0.1509	1.5	0.955	Contact Map
4lmxA	2	0.2406	1.4	0.956	Contact Map
1j83A	1	0.5943	1.4	0.956	Contact Map
2cc6A	5	0.2783	1.3	0.957	Contact Map
4jrfA	3	0.2642	1.3	0.957	Contact Map
3emfA	3	0.4953	1.3	0.957	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0072 seconds.