CstA_5TM - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CstA_5TM - 5TM C-terminal transporter carbon starvation CstA

PFAM:	PF13722	Sequences: MAFWYHFAIMFEALFILTTLDTGTRVGRFILQELLGIVQKPLRNRWPATLIAVALAVALAFWGGINTLWPLFGIANQLLAALALLVATVYLIKMGKYAWVTLIPAVFMLVVTLTA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	115 (113)
Sequences:	15573 (7108)
Seq/√Len:	668.7
META:	0.893

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
88_T	101_T	5.224	1.00
98_A	102_L	3.769	1.00
92_I	98_A	2.483	1.00
102_L	106_V	2.461	1.00
85_L	105_A	2.302	1.00
99_W	103_I	2.219	1.00
111_V	114_T	2.209	1.00
49_T	52_A	2.147	1.00
40_K	43_R	2.098	1.00
41_P	44_N	1.968	1.00
27_G	52_A	1.799	1.00
107_F	111_V	1.759	1.00
88_T	102_L	1.725	1.00
47_P	50_L	1.719	1.00
90_Y	94_M	1.697	1.00
97_Y	100_V	1.670	1.00
48_A	52_A	1.587	1.00
4_W	8_A	1.552	1.00
49_T	53_V	1.548	1.00
31_L	35_L	1.498	1.00
81_A	109_L	1.469	1.00
53_V	56_A	1.466	1.00
6_H	9_I	1.458	1.00
81_A	112_T	1.447	1.00
57_V	61_F	1.440	1.00
109_L	113_L	1.411	1.00
60_A	63_G	1.409	1.00
56_A	59_L	1.389	1.00
81_A	85_L	1.381	1.00
88_T	98_A	1.374	1.00
54_A	58_A	1.359	1.00
48_A	51_I	1.357	1.00
91_L	101_T	1.353	1.00
52_A	56_A	1.333	1.00
98_A	101_T	1.315	1.00
106_V	110_V	1.263	1.00
83_A	87_A	1.254	1.00
67_T	70_P	1.245	1.00
74_I	78_L	1.215	1.00
27_G	56_A	1.206	1.00
56_A	60_A	1.198	1.00
24_T	56_A	1.192	1.00
13_A	17_L	1.182	1.00
53_V	57_V	1.178	1.00
40_K	44_N	1.167	1.00
103_I	106_V	1.162	1.00
87_A	101_T	1.160	1.00
38_V	41_P	1.151	1.00
58_A	61_F	1.126	1.00
8_A	11_F	1.124	1.00
89_V	92_I	1.111	1.00
85_L	109_L	1.111	1.00
110_V	114_T	1.074	1.00
47_P	51_I	1.073	1.00
88_T	92_I	1.047	1.00
8_A	16_I	1.046	1.00
50_L	54_A	1.040	1.00
44_N	47_P	1.029	1.00
92_I	95_G	1.019	1.00
20_L	23_G	1.012	1.00
30_I	34_L	1.011	1.00
36_G	39_Q	0.993	1.00
63_G	66_N	0.989	1.00
80_A	108_M	0.983	1.00
47_P	52_A	0.978	1.00
55_L	59_L	0.974	1.00
5_Y	8_A	0.963	1.00
46_W	50_L	0.956	1.00
99_W	102_L	0.939	1.00
93_K	96_K	0.938	1.00
18_T	22_T	0.918	1.00
54_A	57_V	0.896	1.00
52_A	55_L	0.891	1.00
12_E	16_I	0.866	1.00
4_W	7_F	0.865	1.00
105_A	108_M	0.858	1.00
35_L	39_Q	0.850	1.00
108_M	111_V	0.849	1.00
43_R	47_P	0.847	1.00
65_I	70_P	0.846	1.00
50_L	53_V	0.842	1.00
49_T	57_V	0.831	1.00
48_A	53_V	0.830	1.00
18_T	21_D	0.826	1.00
81_A	84_L	0.824	1.00
11_F	14_L	0.823	1.00
74_I	108_M	0.820	1.00
78_L	112_T	0.819	1.00
31_L	52_A	0.818	1.00
5_Y	9_I	0.813	1.00
105_A	109_L	0.807	1.00
58_A	62_W	0.798	1.00
50_L	55_L	0.794	1.00
19_T	72_F	0.791	1.00
32_Q	48_A	0.786	1.00
81_A	90_Y	0.773	1.00
91_L	98_A	0.764	1.00
19_T	26_V	0.751	1.00
43_R	46_W	0.747	1.00
89_V	93_K	0.734	1.00
53_V	59_L	0.731	1.00
35_L	38_V	0.727	1.00
51_I	55_L	0.725	1.00
49_T	56_A	0.722	1.00
51_I	54_A	0.720	1.00
3_F	6_H	0.718	1.00
11_F	15_F	0.717	1.00
37_I	47_P	0.717	1.00
27_G	30_I	0.714	1.00
82_L	93_K	0.705	1.00
26_V	29_F	0.702	1.00
91_L	94_M	0.702	1.00
42_L	46_W	0.701	1.00
78_L	81_A	0.693	1.00
90_Y	93_K	0.692	1.00
6_H	11_F	0.691	1.00
87_A	91_L	0.689	1.00
36_G	43_R	0.687	1.00
31_L	48_A	0.683	1.00
8_A	12_E	0.680	1.00
87_A	90_Y	0.678	1.00
10_M	17_L	0.676	1.00
66_N	70_P	0.676	1.00
10_M	14_L	0.676	1.00
34_L	38_V	0.675	1.00
84_L	105_A	0.675	1.00
48_A	54_A	0.663	1.00
55_L	58_A	0.661	1.00
91_L	96_K	0.655	1.00
94_M	98_A	0.650	1.00
42_L	47_P	0.625	1.00
73_G	77_Q	0.625	1.00
37_I	43_R	0.623	1.00
107_F	110_V	0.610	1.00
19_T	24_T	0.607	1.00
51_I	56_A	0.603	1.00
102_L	105_A	0.598	1.00
6_H	10_M	0.585	1.00
92_I	102_L	0.580	1.00
108_M	112_T	0.577	1.00
71_L	74_I	0.568	1.00
41_P	45_R	0.564	1.00
86_V	90_Y	0.564	1.00
84_L	87_A	0.562	1.00
66_N	74_I	0.561	1.00
34_L	79_L	0.560	1.00
85_L	89_V	0.560	1.00
19_T	22_T	0.558	1.00
63_G	67_T	0.556	1.00
29_F	32_Q	0.554	1.00
20_L	24_T	0.551	1.00
57_V	60_A	0.543	1.00
65_I	68_L	0.540	1.00
15_F	29_F	0.539	1.00
24_T	53_V	0.538	1.00
83_A	86_V	0.537	1.00
69_W	108_M	0.525	0.99
103_I	107_F	0.516	0.99
98_A	105_A	0.515	0.99
47_P	54_A	0.513	0.99
10_M	13_A	0.513	0.99
37_I	44_N	0.513	0.99
6_H	12_E	0.510	0.99
3_F	19_T	0.508	0.99
13_A	16_I	0.508	0.99
73_G	81_A	0.503	0.99
62_W	66_N	0.503	0.99
14_L	17_L	0.502	0.99
48_A	55_L	0.501	0.99
9_I	12_E	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2wswA	3	0.7652	57.3	0.877	Contact Map
4c7rA	3	0.7826	38.2	0.89	Contact Map
4xp4A	1	1	11.4	0.914	Contact Map
3giaA	1	0.9565	9.8	0.917	Contact Map
2a65A	2	0.9826	5.9	0.925	Contact Map
4wgvA	2	0.9739	4.8	0.928	Contact Map
3m73A	3	0.9478	3.7	0.931	Contact Map
4p02A	1	0.5913	2.3	0.939	Contact Map
3dh4A	3	0.9739	2.2	0.939	Contact Map
3hb3B	1	0.7913	2.2	0.939	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.