zf-3CxxC - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

zf-3CxxC - Zinc-binding domain

PFAM:	PF13695	Sequences: NAFGRFQCSSCSRGWSSAKVAILFHMYSGGQVNMRVFGQRCKKCNQLENPEFDENENLVERILYRCYKWAGVPVERPVYSDKSKGPHDSDLCEACKQG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	98 (96)
Sequences:	511 (375)
Seq/√Len:	38.3
META:	0.213

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
88_D	91_L	5.854	1.00
66_C	69_W	3.833	1.00
92_C	95_C	3.045	1.00
3_F	18_A	2.798	1.00
6_F	17_S	2.704	1.00
23_L	37_F	2.437	1.00
21_A	36_V	2.284	1.00
41_C	44_C	2.269	1.00
8_C	11_C	2.195	0.99
21_A	94_A	2.010	0.99
4_G	20_V	1.857	0.98
63_L	69_W	1.843	0.98
15_W	39_Q	1.761	0.97
8_C	41_C	1.741	0.97
38_G	47_L	1.736	0.97
14_G	19_K	1.677	0.96
8_C	44_C	1.672	0.96
24_F	94_A	1.650	0.96
24_F	32_V	1.599	0.95
23_L	49_N	1.566	0.94
42_K	88_D	1.509	0.93
11_C	41_C	1.490	0.92
58_L	62_I	1.469	0.92
3_F	55_N	1.437	0.91
73_P	90_D	1.435	0.91
80_S	97_Q	1.423	0.91
50_P	86_P	1.414	0.90
35_R	50_P	1.389	0.90
32_V	58_L	1.311	0.87
29_G	45_N	1.265	0.85
8_C	15_W	1.262	0.84
32_V	94_A	1.259	0.84
58_L	94_A	1.221	0.82
85_G	88_D	1.220	0.82
4_G	33_N	1.214	0.82
23_L	35_R	1.187	0.81
10_S	78_V	1.174	0.80
3_F	16_S	1.149	0.78
31_Q	70_A	1.139	0.78
26_M	38_G	1.124	0.77
26_M	31_Q	1.083	0.74
20_V	37_F	1.069	0.73
58_L	66_C	1.008	0.69
73_P	76_R	1.004	0.68
80_S	83_S	0.982	0.66
13_R	88_D	0.977	0.66
5_R	55_N	0.973	0.66
13_R	42_K	0.953	0.64
58_L	67_Y	0.935	0.63
11_C	44_C	0.908	0.60
5_R	19_K	0.897	0.59
58_L	69_W	0.884	0.58
2_A	38_G	0.870	0.57
64_Y	68_K	0.867	0.57
63_L	66_C	0.858	0.56
20_V	25_H	0.848	0.55
48_E	57_N	0.827	0.53
68_K	74_V	0.821	0.53
56_E	60_E	0.820	0.53
62_I	66_C	0.812	0.52
3_F	52_F	0.805	0.51
50_P	59_V	0.802	0.51
33_N	65_R	0.800	0.51
10_S	54_E	0.795	0.50
60_E	68_K	0.763	0.47
42_K	77_P	0.762	0.47
43_K	47_L	0.759	0.47
18_A	42_K	0.756	0.47
84_K	90_D	0.753	0.47
10_S	82_K	0.749	0.46
7_Q	80_S	0.743	0.46
16_S	55_N	0.742	0.46
81_D	84_K	0.738	0.45
27_Y	31_Q	0.723	0.44
5_R	57_N	0.720	0.44
64_Y	69_W	0.718	0.43
78_V	81_D	0.716	0.43
11_C	15_W	0.712	0.43
54_E	83_S	0.709	0.43
13_R	97_Q	0.696	0.42
54_E	76_R	0.695	0.41
26_M	50_P	0.687	0.41
7_Q	73_P	0.682	0.40
67_Y	72_V	0.681	0.40
45_N	51_E	0.681	0.40
71_G	75_E	0.678	0.40
10_S	81_D	0.677	0.40
65_R	93_E	0.676	0.40
38_G	96_K	0.674	0.40
40_R	61_R	0.673	0.40
7_Q	78_V	0.665	0.39
12_S	42_K	0.660	0.38
18_A	34_M	0.658	0.38
38_G	49_N	0.652	0.38
30_G	67_Y	0.648	0.37
43_K	80_S	0.648	0.37
73_P	83_S	0.640	0.37
35_R	52_F	0.640	0.37
4_G	25_H	0.638	0.37
61_R	66_C	0.638	0.37
4_G	21_A	0.637	0.37
72_V	77_P	0.635	0.36
82_K	90_D	0.628	0.36
46_Q	54_E	0.615	0.35
25_H	93_E	0.615	0.35
29_G	76_R	0.613	0.35
17_S	36_V	0.611	0.34
22_I	47_L	0.608	0.34
59_V	63_L	0.608	0.34
12_S	96_K	0.600	0.34
23_L	38_G	0.600	0.34
59_V	91_L	0.598	0.33
47_L	54_E	0.591	0.33
16_S	91_L	0.591	0.33
27_Y	68_K	0.583	0.32
87_H	91_L	0.581	0.32
16_S	47_L	0.574	0.31
45_N	83_S	0.574	0.31
16_S	43_K	0.573	0.31
45_N	54_E	0.569	0.31
40_R	96_K	0.568	0.31
10_S	74_V	0.566	0.31
36_V	86_P	0.562	0.31
24_F	66_C	0.557	0.30
57_N	65_R	0.546	0.29
5_R	30_G	0.541	0.29
20_V	94_A	0.540	0.29
24_F	62_I	0.540	0.29
38_G	91_L	0.539	0.29
29_G	89_S	0.534	0.28
14_G	49_N	0.533	0.28
14_G	59_V	0.531	0.28
9_S	85_G	0.531	0.28
28_S	81_D	0.524	0.28
10_S	70_A	0.519	0.27
74_V	81_D	0.518	0.27
3_F	12_S	0.517	0.27
13_R	43_K	0.516	0.27
87_H	92_C	0.514	0.27
26_M	37_F	0.513	0.27
34_M	93_E	0.509	0.27
40_R	94_A	0.506	0.26
28_S	51_E	0.501	0.26
10_S	16_S	0.500	0.26

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4pofA	3	0.8163	32.4	0.875	Contact Map
2k2dA	1	0.4796	28.6	0.878	Contact Map
3ja82	1	0.8367	28.3	0.878	Contact Map
1ltlA	4	0.8061	27.6	0.879	Contact Map
4me3A	1	0.7959	17.4	0.89	Contact Map
2kdxA	1	0.5204	17	0.89	Contact Map
1qypA	1	0.1939	16.4	0.891	Contact Map
3ja86	1	0.8163	16.1	0.891	Contact Map
3ja87	1	0.8469	15.9	0.891	Contact Map
5aunA	1	0.6837	13.1	0.895	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0057 seconds.