DUF4149 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF4149 - Domain of unknown function (DUF4149)

PFAM:	PF13664	Sequences: LALALWLGGLLFFGFVVAPALFAVLPRELAGAVVGRLFPRYFWLGLVCGAVLLLTLLLRALGGRGRRFRARLLLLLLMLALTLVSQFVLQPRMAALRAQGEH	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	102 (97)
Sequences:	11793 (7925)
Seq/√Len:	804.7
META:	0.918

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
21_L	33_V	3.302	1.00
29_L	32_A	2.582	1.00
26_P	29_L	2.494	1.00
84_V	88_V	2.440	1.00
83_L	87_F	2.335	1.00
36_R	40_R	2.273	1.00
9_G	41_Y	2.117	1.00
24_V	36_R	2.099	1.00
20_A	40_R	2.039	1.00
92_R	95_A	2.037	1.00
90_Q	94_A	2.010	1.00
12_F	17_V	1.825	1.00
51_V	55_T	1.689	1.00
20_A	36_R	1.581	1.00
11_L	15_F	1.561	1.00
2_A	55_T	1.537	1.00
44_L	48_C	1.465	1.00
2_A	48_C	1.462	1.00
28_E	32_A	1.461	1.00
42_F	85_S	1.436	1.00
6_W	45_G	1.411	1.00
25_L	33_V	1.411	1.00
5_L	8_G	1.392	1.00
27_R	30_A	1.390	1.00
20_A	24_V	1.362	1.00
39_P	42_F	1.353	1.00
17_V	37_L	1.353	1.00
9_G	12_F	1.340	1.00
64_R	68_F	1.337	1.00
22_F	38_F	1.333	1.00
32_A	36_R	1.325	1.00
94_A	98_A	1.307	1.00
12_F	16_V	1.282	1.00
88_V	92_R	1.265	1.00
49_G	79_L	1.263	1.00
90_Q	93_M	1.239	1.00
63_G	67_R	1.216	1.00
43_W	47_V	1.203	1.00
7_L	10_L	1.184	1.00
4_A	11_L	1.183	1.00
33_V	37_L	1.176	1.00
63_G	66_R	1.171	1.00
39_P	43_W	1.166	1.00
21_L	34_V	1.163	1.00
21_L	30_A	1.137	1.00
63_G	68_F	1.131	1.00
5_L	11_L	1.120	1.00
46_L	87_F	1.107	1.00
65_G	68_F	1.105	1.00
18_A	34_V	1.095	1.00
85_S	90_Q	1.094	1.00
71_R	74_L	1.092	1.00
36_R	39_P	1.079	1.00
18_A	22_F	1.061	1.00
21_L	37_L	1.054	1.00
61_L	64_R	1.047	1.00
6_W	48_C	1.044	1.00
92_R	96_L	1.028	1.00
13_F	41_Y	1.010	1.00
45_G	82_T	1.010	1.00
42_F	90_Q	0.992	1.00
68_F	71_R	0.980	1.00
14_G	18_A	0.976	1.00
39_P	86_Q	0.967	1.00
73_L	77_L	0.959	1.00
70_A	73_L	0.927	1.00
43_W	86_Q	0.915	1.00
35_G	94_A	0.896	1.00
9_G	44_L	0.895	1.00
94_A	97_R	0.894	1.00
95_A	98_A	0.884	1.00
26_P	30_A	0.840	1.00
46_L	50_A	0.821	1.00
70_A	74_L	0.815	1.00
55_T	59_R	0.812	1.00
10_L	42_F	0.800	1.00
25_L	29_L	0.796	1.00
17_V	21_L	0.783	1.00
56_L	60_A	0.773	1.00
26_P	32_A	0.772	1.00
7_L	11_L	0.762	1.00
52_L	75_L	0.761	1.00
84_V	89_L	0.756	1.00
41_Y	45_G	0.751	1.00
86_Q	90_Q	0.750	1.00
62_G	65_G	0.743	1.00
6_W	78_M	0.734	1.00
20_A	37_L	0.726	1.00
13_F	34_V	0.726	1.00
46_L	86_Q	0.720	1.00
34_V	38_F	0.711	1.00
24_V	32_A	0.710	1.00
6_W	49_G	0.691	1.00
47_V	50_A	0.689	1.00
74_L	78_M	0.688	1.00
56_L	72_L	0.687	1.00
40_R	44_L	0.686	1.00
14_G	42_F	0.685	1.00
43_W	46_L	0.681	1.00
22_F	30_A	0.679	1.00
35_G	39_P	0.672	1.00
2_A	52_L	0.672	1.00
42_F	45_G	0.658	1.00
31_G	34_V	0.655	1.00
81_L	85_S	0.645	1.00
61_L	65_G	0.639	1.00
77_L	81_L	0.631	1.00
45_G	49_G	0.619	1.00
4_A	7_L	0.618	1.00
15_F	19_P	0.618	1.00
43_W	87_F	0.617	1.00
61_L	68_F	0.613	1.00
23_A	40_R	0.613	1.00
9_G	48_C	0.610	1.00
54_L	58_L	0.607	1.00
56_L	59_R	0.605	1.00
62_G	68_F	0.604	1.00
69_R	72_L	0.601	1.00
80_A	84_V	0.601	1.00
26_P	34_V	0.594	1.00
18_A	21_L	0.588	1.00
61_L	66_R	0.587	1.00
60_A	68_F	0.582	1.00
20_A	23_A	0.577	1.00
84_V	92_R	0.576	1.00
62_G	66_R	0.572	1.00
57_L	60_A	0.568	1.00
31_G	35_G	0.554	1.00
53_L	76_L	0.538	1.00
3_L	52_L	0.535	1.00
75_L	85_S	0.530	1.00
31_G	97_R	0.528	1.00
23_A	36_R	0.525	1.00
56_L	71_R	0.525	1.00
22_F	31_G	0.524	1.00
42_F	86_Q	0.521	1.00
67_R	70_A	0.515	1.00
93_M	96_L	0.513	1.00
3_L	7_L	0.507	1.00
20_A	33_V	0.507	1.00
46_L	83_L	0.505	1.00
27_R	35_G	0.504	1.00
17_V	34_V	0.504	1.00
10_L	14_G	0.502	1.00
4_A	9_G	0.502	1.00
21_L	25_L	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4xnjA	1	0.8137	5.4	0.886	Contact Map
4tphA	2	0.8431	4.5	0.89	Contact Map
2cfqA	1	0.9412	4.3	0.891	Contact Map
4k1cA	4	0.8039	4.2	0.891	Contact Map
4k0jA	3	0.8725	4	0.893	Contact Map
3ne5A	3	0.951	3.7	0.895	Contact Map
3w9iA	3	0.9608	3.6	0.895	Contact Map
4uvmA	1	0.951	3.6	0.895	Contact Map
4b4aA	1	0.8137	3.4	0.897	Contact Map
4mt1A	3	0.9216	3.4	0.897	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0054 seconds.