DUF4140 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF4140 - N-terminal domain of unknown function (DUF4140)

PFAM:	PF13600	Sequences: AVTVYPDGAQVTRTATVDLPAGTNELVFTGLPPSLDPNSLRVEGEGGVTILSVRVRRNYLEEAPDEEEIKELEDEIEALEDELAALQDEIAALEAELAFL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	100 (98)
Sequences:	11589 (9046)
Seq/√Len:	913.8
META:	0.908

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
71_E	75_E	2.678	1.00
20_P	24_N	2.648	1.00
44_G	48_V	2.460	1.00
75_E	78_A	2.442	1.00
15_A	28_F	2.393	1.00
83_L	87_Q	2.367	1.00
78_A	82_E	2.268	1.00
86_L	89_E	2.185	1.00
74_D	78_A	2.106	1.00
91_A	94_E	2.075	1.00
82_E	85_A	2.039	1.00
76_I	80_E	1.906	1.00
72_L	76_I	1.888	1.00
90_I	94_E	1.793	1.00
37_P	55_V	1.733	1.00
84_A	88_D	1.678	1.00
42_V	53_V	1.621	1.00
1_A	12_T	1.506	1.00
93_L	96_E	1.484	1.00
94_E	98_A	1.472	1.00
67_E	71_E	1.452	1.00
87_Q	91_A	1.405	1.00
70_K	74_D	1.395	1.00
80_E	84_A	1.391	1.00
79_L	83_L	1.388	1.00
19_L	24_N	1.383	1.00
88_D	91_A	1.362	1.00
80_E	83_L	1.360	1.00
5_Y	10_Q	1.357	1.00
88_D	92_A	1.350	1.00
66_E	71_E	1.335	1.00
85_A	89_E	1.330	1.00
31_L	35_L	1.312	1.00
77_E	81_D	1.301	1.00
92_A	95_A	1.300	1.00
71_E	74_D	1.279	1.00
73_E	77_E	1.264	1.00
95_A	98_A	1.258	1.00
87_Q	90_I	1.254	1.00
79_L	82_E	1.195	1.00
78_A	81_D	1.194	1.00
2_V	11_V	1.187	1.00
84_A	87_Q	1.179	1.00
81_D	85_A	1.164	1.00
40_L	55_V	1.146	1.00
65_D	73_E	1.137	1.00
81_D	84_A	1.129	1.00
23_T	51_L	1.070	1.00
93_L	97_L	1.065	1.00
35_L	40_L	1.060	1.00
73_E	76_I	1.038	1.00
94_E	97_L	1.036	1.00
44_G	50_I	1.019	1.00
65_D	68_E	1.018	1.00
91_A	95_A	1.016	1.00
37_P	57_R	1.012	1.00
35_L	55_V	1.012	1.00
77_E	80_E	0.989	1.00
40_L	53_V	0.984	1.00
83_L	86_L	0.975	1.00
89_E	93_L	0.973	1.00
74_D	77_E	0.968	1.00
75_E	79_L	0.955	1.00
60_L	64_P	0.939	1.00
96_E	99_F	0.934	1.00
21_A	24_N	0.928	1.00
90_I	93_L	0.915	1.00
85_A	88_D	0.898	1.00
76_I	83_L	0.896	1.00
70_K	73_E	0.892	1.00
92_A	97_L	0.872	1.00
19_L	26_L	0.871	1.00
8_G	36_D	0.870	1.00
61_E	64_P	0.838	1.00
68_E	71_E	0.817	1.00
52_S	58_N	0.815	1.00
72_L	75_E	0.801	1.00
45_E	48_V	0.800	1.00
92_A	96_E	0.796	1.00
82_E	86_L	0.780	1.00
3_T	10_Q	0.773	1.00
65_D	70_K	0.773	1.00
17_V	24_N	0.765	1.00
15_A	18_D	0.750	1.00
62_E	65_D	0.748	1.00
1_A	10_Q	0.727	1.00
51_L	55_V	0.720	1.00
53_V	56_R	0.720	1.00
27_V	56_R	0.712	1.00
75_E	82_E	0.708	1.00
86_L	90_I	0.694	1.00
62_E	66_E	0.680	1.00
17_V	26_L	0.679	1.00
13_R	28_F	0.674	1.00
88_D	93_L	0.671	1.00
50_I	54_R	0.669	1.00
19_L	48_V	0.668	1.00
16_T	19_L	0.658	1.00
66_E	70_K	0.649	1.00
83_L	90_I	0.646	1.00
88_D	95_A	0.645	1.00
86_L	93_L	0.638	1.00
73_E	85_A	0.633	1.00
63_A	73_E	0.627	1.00
76_I	79_L	0.624	1.00
80_E	87_Q	0.623	1.00
27_V	30_G	0.620	1.00
60_L	63_A	0.620	1.00
52_S	56_R	0.616	1.00
82_E	89_E	0.608	1.00
31_L	42_V	0.606	1.00
32_P	35_L	0.601	1.00
52_S	55_V	0.600	1.00
74_D	81_D	0.598	1.00
35_L	42_V	0.596	1.00
89_E	92_A	0.594	1.00
87_Q	94_E	0.590	1.00
28_F	31_L	0.580	1.00
18_D	24_N	0.577	1.00
63_A	67_E	0.575	1.00
93_L	99_F	0.574	1.00
2_V	9_A	0.566	1.00
32_P	41_R	0.559	1.00
15_A	19_L	0.552	1.00
79_L	86_L	0.552	1.00
64_P	67_E	0.551	1.00
87_Q	93_L	0.551	1.00
42_V	51_L	0.549	1.00
4_V	13_R	0.548	1.00
15_A	25_E	0.547	1.00
41_R	55_V	0.539	1.00
63_A	66_E	0.533	1.00
2_V	6_P	0.530	1.00
67_E	70_K	0.529	1.00
64_P	68_E	0.529	1.00
48_V	51_L	0.525	1.00
4_V	10_Q	0.523	1.00
33_P	57_R	0.521	1.00
63_A	68_E	0.518	1.00
44_G	49_T	0.513	1.00
91_A	97_L	0.509	1.00
9_A	18_D	0.509	1.00
8_G	42_V	0.507	1.00
1_A	67_E	0.504	1.00
56_R	60_L	0.503	1.00
37_P	54_R	0.501	1.00
31_L	40_L	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4kmqA	1	0.44	26.8	0.844	Contact Map
3zm8A	1	0.94	22.6	0.849	Contact Map
4etpA	1	0.32	17.6	0.857	Contact Map
2vzsA	1	0	16	0.859	Contact Map
1w9sA	1	0.44	13.4	0.864	Contact Map
2vzpA	1	0.42	13	0.864	Contact Map
3hrzB	1	0.5	12.9	0.865	Contact Map
2w47A	1	0.5	12.8	0.865	Contact Map
2oqqA	3	0.36	12.4	0.866	Contact Map
3c9iA	5	0.93	11.8	0.867	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.