FUSC_2 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FUSC_2 - Fusaric acid resistance protein-like

PFAM:	PF13515	Sequences: LALLIARLLGLPHPYWAVLTALIVLQPSVGATLRRALQRLLGTLLGAVLGLLLLALFPGPPLALALLVALAVLLAALLRRRNYALAQAAITALIVLLLALLAPGPGGPWDLALDRVLDTLIGIAVALLV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	129 (123)
Sequences:	33402 (22230)
Seq/√Len:	2004.4
META:	0.752

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
47_A	116_V	2.712	1.00
87_Q	91_T	2.342	1.00
39_R	119_T	2.311	1.00
113_L	117_L	2.198	1.00
6_A	14_P	2.125	1.00
20_T	119_T	2.015	1.00
13_H	16_W	2.000	1.00
86_A	90_I	1.990	1.00
62_L	65_A	1.937	1.00
34_R	38_Q	1.909	1.00
40_L	120_L	1.833	1.00
36_A	123_I	1.830	1.00
28_S	31_A	1.758	1.00
36_A	127_L	1.706	1.00
61_P	65_A	1.706	1.00
33_L	36_A	1.689	1.00
67_L	71_A	1.688	1.00
89_A	92_A	1.659	1.00
4_L	8_L	1.607	1.00
94_I	98_L	1.587	1.00
87_Q	90_I	1.584	1.00
110_D	114_D	1.536	1.00
70_L	74_L	1.533	1.00
45_L	88_A	1.524	1.00
17_A	118_D	1.522	1.00
122_G	126_A	1.514	1.00
47_A	112_A	1.504	1.00
35_R	83_Y	1.488	1.00
72_V	75_A	1.445	1.00
66_L	70_L	1.424	1.00
71_A	75_A	1.417	1.00
46_G	50_G	1.399	1.00
3_L	7_R	1.399	1.00
66_L	69_A	1.380	1.00
40_L	123_I	1.371	1.00
120_L	124_A	1.368	1.00
114_D	117_L	1.357	1.00
82_N	85_L	1.348	1.00
71_A	74_L	1.343	1.00
15_Y	18_V	1.307	1.00
37_L	41_L	1.304	1.00
44_L	116_V	1.304	1.00
76_A	79_R	1.297	1.00
84_A	87_Q	1.297	1.00
17_A	125_V	1.259	1.00
69_A	73_L	1.259	1.00
62_L	66_L	1.249	1.00
73_L	77_L	1.246	1.00
83_Y	87_Q	1.237	1.00
4_L	7_R	1.235	1.00
67_L	70_L	1.231	1.00
55_A	58_P	1.212	1.00
85_L	89_A	1.211	1.00
48_V	52_L	1.211	1.00
107_G	110_D	1.208	1.00
63_A	66_L	1.179	1.00
43_T	115_R	1.172	1.00
51_L	112_A	1.149	1.00
55_A	59_G	1.139	1.00
116_V	120_L	1.134	1.00
61_P	64_L	1.120	1.00
5_I	125_V	1.102	1.00
5_I	9_L	1.099	1.00
52_L	56_L	1.077	1.00
26_Q	35_R	1.073	1.00
70_L	73_L	1.040	1.00
109_W	112_A	1.038	1.00
52_L	55_A	1.034	1.00
50_G	54_L	1.024	1.00
86_A	89_A	1.010	1.00
43_T	119_T	1.005	1.00
16_W	118_D	1.002	1.00
74_L	77_L	0.999	1.00
43_T	91_T	0.987	1.00
73_L	76_A	0.970	1.00
6_A	11_L	0.966	1.00
114_D	118_D	0.945	1.00
20_T	24_V	0.942	1.00
5_I	8_L	0.937	1.00
92_A	95_V	0.937	1.00
7_R	10_G	0.931	1.00
88_A	92_A	0.931	1.00
6_A	10_G	0.930	1.00
20_T	39_R	0.921	1.00
93_L	97_L	0.896	1.00
106_G	110_D	0.893	1.00
45_L	48_V	0.891	1.00
92_A	98_L	0.885	1.00
12_P	114_D	0.878	1.00
118_D	121_I	0.872	1.00
16_W	111_L	0.870	1.00
88_A	91_T	0.868	1.00
71_A	92_A	0.866	1.00
89_A	93_L	0.862	1.00
59_G	63_A	0.846	1.00
68_V	71_A	0.841	1.00
29_V	33_L	0.835	1.00
90_I	93_L	0.830	1.00
85_L	90_I	0.829	1.00
92_A	96_L	0.821	1.00
8_L	11_L	0.815	1.00
93_L	96_L	0.814	1.00
72_V	76_A	0.812	1.00
92_A	97_L	0.803	1.00
113_L	116_V	0.801	1.00
29_V	32_T	0.782	1.00
6_A	9_L	0.778	1.00
13_H	114_D	0.777	1.00
90_I	94_I	0.776	1.00
19_L	23_I	0.775	1.00
38_Q	84_A	0.772	1.00
17_A	121_I	0.770	1.00
86_A	91_T	0.762	1.00
82_N	86_A	0.759	1.00
105_P	108_P	0.755	1.00
16_W	43_T	0.752	1.00
65_A	69_A	0.749	1.00
3_L	18_V	0.738	1.00
26_Q	32_T	0.734	1.00
21_A	126_A	0.731	1.00
93_L	98_L	0.730	1.00
7_R	12_P	0.729	1.00
96_L	99_A	0.728	1.00
25_L	126_A	0.727	1.00
117_L	121_I	0.721	1.00
57_F	60_P	0.708	1.00
115_R	118_D	0.705	1.00
92_A	99_A	0.696	1.00
24_V	36_A	0.696	1.00
109_W	113_L	0.691	1.00
83_Y	86_A	0.686	1.00
14_P	17_A	0.680	1.00
121_I	125_V	0.676	1.00
55_A	60_P	0.676	1.00
84_A	88_A	0.674	1.00
22_L	26_Q	0.657	1.00
6_A	18_V	0.655	1.00
84_A	89_A	0.646	1.00
17_A	21_A	0.646	1.00
37_L	40_L	0.642	1.00
94_I	99_A	0.641	1.00
41_L	44_L	0.637	1.00
98_L	101_L	0.634	1.00
123_I	127_L	0.623	1.00
3_L	11_L	0.623	1.00
43_T	118_D	0.621	1.00
86_A	94_I	0.620	1.00
91_T	98_L	0.620	1.00
44_L	48_V	0.613	1.00
11_L	118_D	0.609	1.00
85_L	91_T	0.609	1.00
106_G	109_W	0.600	1.00
67_L	75_A	0.599	1.00
15_Y	19_L	0.598	1.00
42_G	46_G	0.595	1.00
24_V	126_A	0.589	1.00
14_P	118_D	0.585	1.00
121_I	124_A	0.583	1.00
124_A	128_L	0.582	1.00
58_P	63_A	0.580	1.00
48_V	51_L	0.577	1.00
79_R	86_A	0.576	1.00
36_A	40_L	0.575	1.00
38_Q	41_L	0.563	1.00
95_V	99_A	0.562	1.00
97_L	100_L	0.558	1.00
65_A	71_A	0.558	1.00
28_S	32_T	0.553	1.00
50_G	96_L	0.547	1.00
23_I	119_T	0.540	1.00
49_L	88_A	0.538	1.00
88_A	95_V	0.534	1.00
26_Q	29_V	0.533	1.00
91_T	99_A	0.527	1.00
125_V	128_L	0.527	1.00
60_P	63_A	0.527	1.00
78_L	81_R	0.526	1.00
35_R	38_Q	0.522	1.00
76_A	80_R	0.517	1.00
31_A	34_R	0.514	1.00
46_G	88_A	0.514	1.00
65_A	68_V	0.513	1.00
68_V	76_A	0.512	1.00
16_W	20_T	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2i88A	1	0.3333	4.9	0.889	Contact Map
4f35D	2	0.7054	2.5	0.904	Contact Map
4qtnA	3	0.9767	2	0.909	Contact Map
4pgrA	1	0.7674	1.5	0.915	Contact Map
4wrtA	1	0.1705	1.2	0.921	Contact Map
2mpnA	2	0.1783	1	0.925	Contact Map
3k3fA	3	0.7364	0.9	0.925	Contact Map
3gd8A	4	0.4651	0.7	0.931	Contact Map
4jkvA	2	0.2946	0.7	0.931	Contact Map
2xq2A	2	0.9612	0.7	0.932	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.