MUG113 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MUG113 - Meiotically up-regulated gene 113

PFAM:	PF13455	Sequences: YKIGMTRDPEDRIKELQTASPFPFEVVATIETDNVIDAPKLEKLLHRRFADKRVNGVRPRKFGKPVEWFRVSLEEIKEAIERI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	83 (69)
Sequences:	19737 (14084)
Seq/√Len:	1695.5
META:	0.92

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
5_M	39_P	4.734	1.00
5_M	38_A	3.092	1.00
52_K	75_E	2.118	1.00
45_L	49_F	2.037	1.00
46_H	69_F	1.853	1.00
71_V	76_I	1.756	1.00
54_V	70_R	1.728	1.00
8_D	11_D	1.628	1.00
16_L	19_A	1.602	1.00
39_P	43_K	1.574	1.00
37_D	40_K	1.570	1.00
1_Y	76_I	1.523	1.00
72_S	75_E	1.495	1.00
40_K	44_L	1.491	1.00
43_K	47_R	1.476	1.00
71_V	75_E	1.408	1.00
1_Y	73_L	1.407	1.00
49_F	71_V	1.337	1.00
9_P	29_T	1.319	1.00
17_Q	20_S	1.307	1.00
6_T	9_P	1.300	1.00
44_L	48_R	1.275	1.00
3_I	49_F	1.268	1.00
9_P	13_I	1.255	1.00
26_V	29_T	1.246	1.00
12_R	67_E	1.242	1.00
17_Q	23_P	1.210	1.00
11_D	15_E	1.208	1.00
50_A	53_R	1.206	1.00
53_R	56_G	1.203	1.00
13_I	17_Q	1.194	1.00
7_R	38_A	1.176	1.00
32_T	41_L	1.146	1.00
38_A	41_L	1.141	1.00
73_L	77_K	1.139	1.00
13_I	16_L	1.090	1.00
49_F	79_A	1.076	1.00
10_E	14_K	1.074	1.00
25_E	28_A	1.071	1.00
28_A	77_K	1.069	1.00
47_R	50_A	1.041	1.00
48_R	79_A	1.036	1.00
17_Q	55_N	1.034	1.00
1_Y	71_V	1.023	1.00
15_E	19_A	0.927	1.00
41_L	45_L	0.916	1.00
11_D	14_K	0.896	1.00
52_K	71_V	0.863	1.00
30_I	33_D	0.834	1.00
75_E	78_E	0.823	1.00
55_N	58_R	0.816	1.00
13_I	26_V	0.815	1.00
24_F	68_W	0.806	1.00
41_L	44_L	0.791	1.00
20_S	24_F	0.790	1.00
45_L	79_A	0.784	1.00
74_E	78_E	0.782	1.00
45_L	80_I	0.779	1.00
10_E	26_V	0.763	1.00
22_F	25_E	0.754	1.00
33_D	37_D	0.746	1.00
14_K	18_T	0.735	1.00
10_E	13_I	0.734	1.00
29_T	32_T	0.717	1.00
13_I	19_A	0.709	1.00
16_L	20_S	0.706	1.00
16_L	24_F	0.702	1.00
21_P	24_F	0.697	1.00
32_T	38_A	0.690	1.00
45_L	76_I	0.684	1.00
24_F	33_D	0.670	1.00
10_E	29_T	0.666	1.00
48_R	52_K	0.666	1.00
44_L	47_R	0.663	1.00
24_F	27_V	0.653	1.00
2_K	67_E	0.650	1.00
26_V	32_T	0.633	1.00
49_F	76_I	0.629	1.00
27_V	73_L	0.626	1.00
50_A	56_G	0.626	1.00
43_K	46_H	0.623	1.00
17_Q	68_W	0.619	1.00
3_I	46_H	0.612	1.00
75_E	79_A	0.587	1.00
15_E	18_T	0.577	1.00
14_K	17_Q	0.567	1.00
5_M	43_K	0.565	1.00
52_K	72_S	0.550	1.00
28_A	31_E	0.548	1.00
25_E	32_T	0.539	1.00
71_V	79_A	0.539	1.00
5_M	37_D	0.538	1.00
24_F	28_A	0.538	1.00
25_E	29_T	0.535	1.00
16_L	46_H	0.535	1.00
3_I	69_F	0.532	1.00
16_L	68_W	0.521	1.00
3_I	45_L	0.520	1.00
12_R	42_E	0.510	1.00
21_P	68_W	0.509	1.00
42_E	46_H	0.509	1.00
45_L	48_R	0.506	1.00
21_P	25_E	0.503	1.00
24_F	32_T	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4xlgA	1	0.7952	71	0.77	Contact Map
1zg2A	1	0.8795	68.7	0.774	Contact Map
1ywlA	1	0.8072	61.6	0.784	Contact Map
1yd0A	1	0.6627	13.4	0.849	Contact Map
1yd6A	5	0.7349	11.1	0.855	Contact Map
1mk0A	1	0.7349	9.7	0.858	Contact Map
1kcmA	2	0.9518	9.7	0.858	Contact Map
1f6kA	3	0.7952	6.9	0.867	Contact Map
4n4pA	3	0.8313	6.1	0.871	Contact Map
2zxqA	1	0.8795	5.2	0.874	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.