DUF4093 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF4093 - Domain of unknown function (DUF4093)

PFAM:	PF13331	Sequences: KLGVEHASPEAIREALEKAETEEPEEEITKADLYELGLSGGPDSAERREKLGKKLGIGYLNAKQLLKRLNMFGITREEFEEAL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	83 (82)
Sequences:	3364 (2677)
Seq/√Len:	295.6
META:	0.708

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
36_L	79_F	3.698	1.00
1_K	6_H	2.355	1.00
76_R	80_E	2.274	1.00
9_P	13_R	2.254	1.00
14_E	18_K	2.216	1.00
32_D	76_R	2.146	1.00
30_K	63_K	1.949	1.00
75_T	78_E	1.883	1.00
58_G	68_R	1.874	1.00
66_L	70_N	1.776	1.00
13_R	17_E	1.774	1.00
43_D	46_E	1.714	1.00
45_A	49_E	1.701	1.00
39_S	62_A	1.688	1.00
52_G	60_L	1.655	1.00
37_G	41_G	1.654	1.00
8_S	11_A	1.634	1.00
14_E	17_E	1.621	1.00
28_I	69_L	1.514	1.00
52_G	65_L	1.513	1.00
26_E	76_R	1.495	1.00
41_G	44_S	1.440	1.00
33_L	66_L	1.393	1.00
60_L	68_R	1.382	1.00
60_L	64_Q	1.352	1.00
29_T	32_D	1.306	1.00
46_E	50_K	1.304	1.00
36_L	80_E	1.261	1.00
64_Q	68_R	1.259	1.00
26_E	70_N	1.246	1.00
77_E	81_E	1.218	1.00
37_G	47_R	1.210	1.00
30_K	39_S	1.196	1.00
44_S	47_R	1.195	1.00
30_K	34_Y	1.176	1.00
46_E	49_E	1.104	1.00
31_A	35_E	1.086	1.00
52_G	57_I	1.083	1.00
50_K	54_K	1.073	1.00
64_Q	67_K	1.069	1.00
30_K	66_L	1.054	1.00
50_K	53_K	1.038	1.00
15_A	19_A	1.038	1.00
51_L	65_L	1.017	1.00
43_D	47_R	1.001	1.00
7_A	12_I	0.989	1.00
32_D	66_L	0.980	1.00
40_G	44_S	0.972	1.00
32_D	79_F	0.955	1.00
65_L	69_L	0.940	1.00
2_L	6_H	0.937	1.00
52_G	58_G	0.934	1.00
49_E	59_Y	0.932	1.00
18_K	56_G	0.924	1.00
54_K	82_A	0.912	1.00
78_E	81_E	0.889	1.00
27_E	76_R	0.887	1.00
11_A	14_E	0.881	1.00
67_K	71_M	0.869	1.00
33_L	69_L	0.862	1.00
74_I	78_E	0.853	1.00
10_E	14_E	0.852	1.00
16_L	19_A	0.842	1.00
4_V	11_A	0.825	1.00
60_L	65_L	0.818	1.00
15_A	18_K	0.808	1.00
47_R	50_K	0.790	0.99
33_L	65_L	0.761	0.99
7_A	11_A	0.760	0.99
68_R	72_F	0.747	0.99
35_E	80_E	0.739	0.99
9_P	16_L	0.725	0.99
7_A	16_L	0.725	0.99
68_R	71_M	0.720	0.99
30_K	62_A	0.714	0.99
77_E	80_E	0.706	0.99
52_G	59_Y	0.696	0.99
47_R	54_K	0.696	0.99
49_E	53_K	0.693	0.99
51_L	55_L	0.680	0.98
32_D	36_L	0.673	0.98
62_A	65_L	0.670	0.98
69_L	74_I	0.668	0.98
76_R	79_F	0.668	0.98
51_L	79_F	0.664	0.98
55_L	82_A	0.655	0.98
2_L	60_L	0.653	0.98
16_L	59_Y	0.642	0.98
10_E	13_R	0.642	0.98
10_E	17_E	0.639	0.98
11_A	15_A	0.638	0.98
79_F	82_A	0.635	0.97
33_L	39_S	0.635	0.97
45_A	59_Y	0.634	0.97
27_E	70_N	0.611	0.97
7_A	15_A	0.596	0.96
4_V	59_Y	0.594	0.96
35_E	76_R	0.592	0.96
32_D	80_E	0.590	0.96
37_G	43_D	0.582	0.96
61_N	68_R	0.580	0.96
13_R	16_L	0.579	0.96
25_E	73_G	0.576	0.96
6_H	57_I	0.568	0.95
64_Q	72_F	0.565	0.95
47_R	51_L	0.559	0.95
54_K	79_F	0.558	0.95
63_K	67_K	0.556	0.95
55_L	74_I	0.554	0.95
38_L	44_S	0.554	0.95
12_I	15_A	0.554	0.95
61_N	74_I	0.532	0.93
59_Y	64_Q	0.528	0.93
52_G	56_G	0.528	0.93
28_I	79_F	0.525	0.93
34_Y	40_G	0.524	0.93
30_K	33_L	0.522	0.93
32_D	35_E	0.521	0.93
7_A	19_A	0.519	0.92
12_I	48_R	0.514	0.92
1_K	59_Y	0.506	0.92
23_E	53_K	0.502	0.91
20_E	73_G	0.500	0.91

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2pvbA	1	0.8916	34	0.865	Contact Map
4mzjA	1	0.9157	28.7	0.87	Contact Map
1m45A	1	0.9157	28.3	0.871	Contact Map
1wdcC	1	0.9639	27.9	0.871	Contact Map
4ociA	2	0.9398	25.9	0.873	Contact Map
2fcjA	2	0.4096	24.6	0.874	Contact Map
2aaoA	2	0.8554	24.2	0.875	Contact Map
1bu3A	2	0.9036	23.6	0.875	Contact Map
4fp9B	2	0.759	23.2	0.876	Contact Map
1q80A	1	1	20.9	0.878	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.