Mucin2_WxxW - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Mucin2_WxxW - Mucin-2 protein WxxW repeating region

PFAM:	PF13330	Sequences: EWTDWFDRDDPSGGGDFETLSNLRAYGYKVCENPTAIECRAVGTGVPLEELGQVVTCDLSVGLVCRNSDQPGGMCLDYEVRFLC	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	84 (84)
Sequences:	1864 (1466)
Seq/√Len:	160.0
META:	0.387

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
39_C	57_C	4.522	1.00
40_R	79_E	4.388	1.00
38_E	81_R	4.135	1.00
53_Q	76_L	2.835	1.00
6_F	23_L	2.570	1.00
55_V	63_L	2.150	1.00
14_G	17_F	2.143	1.00
7_D	10_D	2.037	1.00
7_D	42_V	1.998	1.00
15_G	67_N	1.958	1.00
56_T	69_D	1.901	1.00
53_Q	72_G	1.752	1.00
42_V	79_E	1.705	1.00
53_Q	78_Y	1.700	1.00
36_A	83_L	1.669	1.00
41_A	44_T	1.627	1.00
57_C	63_L	1.580	1.00
58_D	61_V	1.543	1.00
24_R	30_V	1.505	1.00
23_L	82_F	1.392	1.00
9_D	13_G	1.318	1.00
56_T	64_V	1.292	1.00
57_C	83_L	1.283	1.00
3_T	82_F	1.283	1.00
41_A	51_L	1.259	1.00
70_Q	74_M	1.235	1.00
70_Q	73_G	1.206	1.00
39_C	63_L	1.200	1.00
66_R	69_D	1.200	1.00
8_R	23_L	1.198	1.00
48_L	51_L	1.161	1.00
9_D	16_D	1.159	1.00
5_W	38_E	1.146	1.00
41_A	76_L	1.143	1.00
8_R	22_N	1.139	1.00
7_D	77_D	1.129	1.00
17_F	66_R	1.126	1.00
17_F	64_V	1.061	0.99
46_V	50_E	1.060	0.99
65_C	75_C	1.059	0.99
24_R	32_E	1.021	0.99
35_T	83_L	0.994	0.99
37_I	80_V	0.985	0.99
1_E	83_L	0.984	0.99
37_I	82_F	0.983	0.99
16_D	78_Y	0.963	0.99
64_V	69_D	0.939	0.98
20_L	82_F	0.924	0.98
56_T	66_R	0.916	0.98
45_G	79_E	0.914	0.98
23_L	80_V	0.890	0.98
19_T	22_N	0.870	0.97
40_R	45_G	0.856	0.97
63_L	78_Y	0.856	0.97
23_L	26_Y	0.847	0.97
38_E	83_L	0.818	0.96
39_C	83_L	0.799	0.96
54_V	69_D	0.793	0.96
6_F	30_V	0.790	0.96
53_Q	70_Q	0.784	0.95
2_W	83_L	0.773	0.95
47_P	50_E	0.769	0.95
20_L	24_R	0.765	0.95
5_W	81_R	0.762	0.95
18_E	37_I	0.746	0.94
35_T	72_G	0.734	0.93
21_S	25_A	0.732	0.93
10_D	77_D	0.729	0.93
3_T	34_P	0.729	0.93
27_G	39_C	0.720	0.93
48_L	55_V	0.713	0.92
20_L	30_V	0.700	0.92
3_T	6_F	0.688	0.91
41_A	52_G	0.681	0.91
8_R	14_G	0.671	0.90
4_D	81_R	0.669	0.90
67_N	70_Q	0.650	0.89
11_P	16_D	0.642	0.88
75_C	84_C	0.637	0.88
20_L	59_L	0.632	0.87
37_I	59_L	0.620	0.86
23_L	30_V	0.619	0.86
46_V	52_G	0.616	0.86
54_V	70_Q	0.609	0.85
48_L	66_R	0.603	0.85
41_A	48_L	0.600	0.84
8_R	19_T	0.598	0.84
4_D	28_Y	0.591	0.83
29_K	35_T	0.590	0.83
36_A	81_R	0.588	0.83
48_L	52_G	0.588	0.83
4_D	29_K	0.582	0.82
8_R	25_A	0.582	0.82
31_C	84_C	0.578	0.82
47_P	63_L	0.573	0.82
34_P	70_Q	0.560	0.80
2_W	36_A	0.555	0.79
43_G	52_G	0.554	0.79
8_R	26_Y	0.553	0.79
1_E	34_P	0.551	0.79
44_T	48_L	0.550	0.79
29_K	68_S	0.544	0.78
32_E	54_V	0.540	0.78
9_D	12_S	0.535	0.77
52_G	57_C	0.531	0.76
56_T	61_V	0.531	0.76
45_G	48_L	0.529	0.76
45_G	52_G	0.528	0.76
52_G	70_Q	0.526	0.76
77_D	84_C	0.526	0.76
6_F	28_Y	0.523	0.75
47_P	51_L	0.520	0.75
6_F	29_K	0.515	0.74
35_T	45_G	0.512	0.74
42_V	77_D	0.509	0.73
4_D	35_T	0.506	0.73
29_K	32_E	0.505	0.73
24_R	27_G	0.505	0.73
75_C	78_Y	0.505	0.73
30_V	36_A	0.503	0.73
10_D	16_D	0.503	0.73
4_D	13_G	0.503	0.73
60_S	74_M	0.502	0.72
41_A	46_V	0.501	0.72
8_R	11_P	0.501	0.72
20_L	23_L	0.500	0.72

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4e45E	1	0.5476	6.8	0.9	Contact Map
2lpbB	1	0.1905	4.2	0.909	Contact Map
1e0fI	1	0.2262	2	0.923	Contact Map
3keyA	1	0.2619	1.7	0.925	Contact Map
3ojyA	1	0.381	1.7	0.926	Contact Map
2jq3A	1	0.3214	1.6	0.927	Contact Map
1l3aA	4	0.3095	1.6	0.927	Contact Map
2dcvA	1	0.2381	1.6	0.927	Contact Map
4jd0A	1	0.369	1.5	0.928	Contact Map
4m1gA	2	0.381	1.4	0.929	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.005 seconds.